PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_12890V3.5.p
Common NamePpVNS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 388aa    MW: 44259.5 Da    PI: 6.3594
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_12890V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-5181401128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                        +p+GfrFhPtdeelv +yL kkv+++k++l + i+++d+yk+ePwdL++        +++++++yfFs++dkky+tg+r+nrat++g+Wkat
  Pp3c3_12890V3.5.p   8 VPVGFRFHPTDEELVGYYLPKKVTARKIDL-DLIRDLDLYKLEPWDLQElckiqaDSNEKQTDYYFFSRKDKKYPTGNRANRATTKGFWKAT 98 
                        599***************************.99**************95565533222345577**************************** PP

                NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        g+dk++++k ++l+g++ktLvfy+grap+g+ktdW+mhe+rl
  Pp3c3_12890V3.5.p  99 GRDKPIHTKLQTLIGMRKTLVFYQGRAPHGVKTDWIMHEFRL 140
                        ********9999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-545162IPR003441NAC domain
PROSITE profilePS5100554.3638162IPR003441NAC domain
PfamPF023652.5E-269140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MTQPTTKVPV GFRFHPTDEE LVGYYLPKKV TARKIDLDLI RDLDLYKLEP WDLQELCKIQ  60
ADSNEKQTDY YFFSRKDKKY PTGNRANRAT TKGFWKATGR DKPIHTKLQT LIGMRKTLVF  120
YQGRAPHGVK TDWIMHEFRL DDGPGRPAHE DGGWVVCRVF KKNKNLKLKL QEKAVSYEEQ  180
LGLPSEHMGS PDILSGGARF AYPEQTRYAD QPQYGSIKQE IINLDEYQSR HSDMYVNQFS  240
AQMEMPTKVE NQSHSMPSSS ISDQARSYLC RVLSFRRPDD YLNLNPYPET PANPENSTEY  300
TEPQTSGSGS DGDTHEEESI LGNLDSVDWS ALLQEPTSGK DLRCPTPVST KANADDMTAL  360
IQLRRQNSDI FSSLDLWNYA HVAQQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-44816215168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8980820.0AB898082.1 Physcomitrella patens PpVNS2 mRNA for NAC transcription factor PpVNS2, complete cds, ecotype: Gransden 2004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLX5IAY40.0X5IAY4_PHYPA; NAC transcription factor PpVNS2
STRINGPP1S161_73V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.14e-62NAC 007
Publications ? help Back to Top
  1. Xu B, et al.
    Contribution of NAC transcription factors to plant adaptation to land.
    Science, 2014. 343(6178): p. 1505-8
    [PMID:24652936]