PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_11670V3.2.p
Common NamePHYPADRAFT_164706, PpLFY2, PPLFY2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LFY
Protein Properties Length: 349aa    MW: 39962.7 Da    PI: 6.8457
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_11670V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY473.11.9e-1442934639385
            FLO_LFY  39 aaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrr 130
                          +a a r+ r+l+elfk++Gv+ +tv+ ++++Gft stL++mkdee+d ++ks++e ++ldll+Ge++Gikaavra+rr + ee  e++r+
  Pp3c3_11670V3.2.p  29 DGTALAGRESRRLKELFKDFGVQPSTVTVMGQMGFTLSTLINMKDEEVDFVIKSMIEEYHLDLLMGEQFGIKAAVRAKRRLVVEEL-EQQRM 119
                        55667788899*******************************************************************99888744.45555 PP

            FLO_LFY 131 kllsedeetaldalsqeg..lseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegs 220
                                  + als+e     eep+     +   g+++l++ +l++ ++ +s++e kka+k++q+++++ke                    
  Pp3c3_11670V3.2.p 120 ---------DMAALSNEKkrRLEEPSDGLLLK--DGNGSLEALGLLGLTDPDSDSEGKKAAKRRQRKRRSKE-------------------V 181
                        .........34566666521334444444334..44555669999***999999999999887777777766...................7 PP

            FLO_LFY 221 gedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalh 312
                        g+dgeer+rehPfivtepge a+gkknGLDYLfdLyeqC++fL +vq+iake+GekcP+kvtn+vfr+ak +ga yinkPkmr+YvhCYalh
  Pp3c3_11670V3.2.p 182 GDDGEERPREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALH 273
                        899***************************************************************************************** PP

            FLO_LFY 313 cLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                        cLd e+sn+lr++fkergenvGaw+qacy plv++a++++wdid +fn++++L+iWYvPtkLrqLCh+er+k+
  Pp3c3_11670V3.2.p 274 CLDVETSNNLRKEFKERGENVGAWCQACYFPLVTLARQNEWDIDDLFNQNDKLRIWYVPTKLRQLCHIERMKH 346
                        **********************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.4E-11427346IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVDDCPVHNM AHFDMVQAEP TALLYKRPDG TALAGRESRR LKELFKDFGV QPSTVTVMGQ  60
MGFTLSTLIN MKDEEVDFVI KSMIEEYHLD LLMGEQFGIK AAVRAKRRLV VEELEQQRMD  120
MAALSNEKKR RLEEPSDGLL LKDGNGSLEA LGLLGLTDPD SDSEGKKAAK RRQRKRRSKE  180
VGDDGEERPR EHPFIVTEPG EPAKGKKNGL DYLFDLYEQC GKFLEEVQHI AKEKGEKCPS  240
KVTNEVFRHA KLTGAGYINK PKMRDYVHCY ALHCLDVETS NNLRKEFKER GENVGAWCQA  300
CYFPLVTLAR QNEWDIDDLF NQNDKLRIWY VPTKLRQLCH IERMKHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A1e-1231803474171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B1e-1231803474171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165172KKAAKRRQ
2172177QRKRRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1640.0protonema
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in both male and female cones, vegetative buds and needles, but not in the roots.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0522520.0AB052252.1 Physcomitrella patens PPLFY2 mRNA for FLORICAULA/LEAFY homolog 2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369275.10.0floricaula/leafy-like protein FL1 isoform X2
SwissprotO044071e-133NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLA0A2K1KU340.0A0A2K1KU34_PHYPA; Uncharacterized protein
STRINGPP1S74_224V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.15e-85floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Himi S, et al.
    Evolution of MADS-box gene induction by FLO/LFY genes.
    J. Mol. Evol., 2001 Oct-Nov. 53(4-5): p. 387-93
    [PMID:11675598]
  2. Tanahashi T,Sumikawa N,Kato M,Hasebe M
    Diversification of gene function: homologs of the floral regulator FLO/LFY control the first zygotic cell division in the moss Physcomitrella patens.
    Development, 2005. 132(7): p. 1727-36
    [PMID:15743879]
  3. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]