PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_4940V3.5.p
Common NamePHYPADRAFT_174493, Pphb7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 344aa    MW: 38323.7 Da    PI: 4.8857
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_4940V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1896149356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c2_4940V3.5.p  96 KKRRLSLEQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 149
                       4558999**********************************************9 PP

2HD-ZIP_I/II127.36.4e-4195187193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls eqv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+Lk+ayd+lk++ e+++ ++++L++e+++
  Pp3c2_4940V3.5.p  95 EKKRRLSLEQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYETLKKAYDRLKADFEAVTLDTSALKAEVSR 187
                       69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.58E-2072153IPR009057Homeodomain-like
PROSITE profilePS5007117.55691151IPR001356Homeobox domain
SMARTSM003897.1E-1694155IPR001356Homeobox domain
PfamPF000461.3E-1596149IPR001356Homeobox domain
CDDcd000866.05E-1796152No hitNo description
Gene3DG3DSA:1.10.10.602.8E-1998158IPR009057Homeodomain-like
PRINTSPR000316.2E-6122131IPR000047Helix-turn-helix motif
PROSITE patternPS000270126149IPR017970Homeobox, conserved site
PRINTSPR000316.2E-6131147IPR000047Helix-turn-helix motif
PfamPF021834.7E-15151190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MVVPSLPAFG GQNAMLRRNI DNNTDTLISL LQGSCSPRVS MQQGYVAVPR SSESLENMMG  60
ACGQKLPYFS SFDGPSVEEQ EDVDEGIDEF AHHVEKKRRL SLEQVRSLER NFEVENKLEP  120
ERKMQLAKEL GLQPRQVAVW FQNRRARWKT KQLERDYETL KKAYDRLKAD FEAVTLDTSA  180
LKAEVSRLKG ISNDDVKPAE FVQGKCDTTS HPASPAQSER SDIVSSRNRT TPTIHVDPVA  240
PEEAGAHLTM SSDSNSSEVM DADSPRTSHT SASRSTLSTS VVQPDEGLGV AQYPHFSPEN  300
FVGPNMPEIC ADQSLASQVK LEEIHSFNPD QTFLLLPNWW DWA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143151RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.65050.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280780.0AB028078.2 Physcomitrella patens mRNA for homeobox protein PpHB7, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024368951.10.0homeobox-leucine zipper protein HOX20-like isoform X1
TrEMBLA9RG470.0A9RG47_PHYPA; Uncharacterized protein
STRINGPP1S7_280V6.40.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-43homeobox 1
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]