PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_4771V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 122aa    MW: 13567.6 Da    PI: 8.2885
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_4771V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26062.41.2e-196583486
            DUF260 34 hklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
                        +FG++nv+k+l++lp+ +red ++sl+yeA+ar++dPvyG+vg i+ lqqq
  Pp3c2_4771V3.1.p  6 TGVFGVANVTKMLHDLPPPHREDCVNSLAYEADARVQDPVYGCVGAISILQQQ 58
                      569***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.185174IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-18558IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MRSQATGVFG VANVTKMLHD LPPPHREDCV NSLAYEADAR VQDPVYGCVG AISILQQQDF  60
TNLLNPLLWP PTTLNLPTLI ALLHQLIRNI KKHQPINNHN PLLHHVRTQG LHVHSTSYGF  120
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-218584696LOB family transfactor Ramosa2.1
5ly0_B2e-218584696LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K1L0874e-84A0A2K1L087_PHYPA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-22LOB domain-containing protein 25