PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_30770V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 649aa    MW: 71759.6 Da    PI: 5.8088
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_30770V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4692.7e-1432796472373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cAeavs++d+ la+ l+a+l++ +s +gdpmqRlaay++e+L ar+a s++++y +l+++e +   + + l+a+++++ev+P++kf
  Pp3c2_30770V3.1.p 279 EQLLVACAEAVSNNDMPLANVLIAQLNQEVSIHGDPMQRLAAYMVEGLVARVAASGKSIYTSLKCKEPP---TRDLLSAMQILYEVCPYFKF 367
                        689*****************************************************************9...899***************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        ++++aN aI ea+++e+rvHiiDf+i qG+QW +L++aLa+Rp+gpp++RiTg+++p +g   +  +e +g+rLa++Ae++gvpf f++ va
  Pp3c2_30770V3.1.p 368 GYMAANGAIAEAFQNESRVHIIDFQIAQGTQWTTLIRALAARPGGPPHVRITGIDDPMPGptPNVGVEMVGKRLANLAEAVGVPFVFHP-VA 458
                        *********************************************************99999999************************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        k+ +++e ++L+ ++gEalaVn++lqlh+++desv+++++rd++L+++k+l+Pkv+++veqe+++n+++F+ rfleal+yysa+f+sl+ +l
  Pp3c2_30770V3.1.p 459 KKGTEIEAWMLERQQGEALAVNFALQLHHMPDESVCTSNPRDRMLHMIKGLNPKVMTLVEQESNTNTAPFFPRFLEALSYYSAIFESLDITL 550
                        ******************************************************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        +res+er++vE+++l+r+ivn++aceg +r+erhe ++kWr+rl++aGF+p+pls+++++++k+ll+ +++  yr++ee g+l+lgWk+rpL
  Pp3c2_30770V3.1.p 551 ARESKERVNVEQQCLARDIVNIIACEGIDRVERHEMMGKWRARLTMAGFRPYPLSQTVNNTIKTLLESYSD-KYRLKEEGGALFLGWKNRPL 641
                        **********************************************************************5.5******************* PP

               GRAS 368 vsvSaW 373
                        ++ SaW
  Pp3c2_30770V3.1.p 642 IVSSAW 647
                        ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.595252629IPR005202Transcription factor GRAS
PfamPF035149.2E-141279647IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MSVQYEPELG SMVLTPGFPP GKEREYFSDT ANSQQAPNYF GARTSYANDH RQNAYGLKIK  60
SHGSPISPLS PQDSSHAASD NGQRMSGGWN SASYQSESSS HSDTSLEGHV KQEEADYYGR  120
QYGHIEQSEG SLAYHNSPSS VLKPMPYPGA IAQGYSMPNY QQDGRHVPDG QYAQSQSNCA  180
QRNPEMVHML QVLENALLDD DDDDDHRAPE GNWADTIEKF LAADNSAIKP SPVTSRTTQP  240
DYGKQQCNEN AINFTGAVTA RVEELALQKL VVATRSRSEQ LLVACAEAVS NNDMPLANVL  300
IAQLNQEVSI HGDPMQRLAA YMVEGLVARV AASGKSIYTS LKCKEPPTRD LLSAMQILYE  360
VCPYFKFGYM AANGAIAEAF QNESRVHIID FQIAQGTQWT TLIRALAARP GGPPHVRITG  420
IDDPMPGPTP NVGVEMVGKR LANLAEAVGV PFVFHPVAKK GTEIEAWMLE RQQGEALAVN  480
FALQLHHMPD ESVCTSNPRD RMLHMIKGLN PKVMTLVEQE SNTNTAPFFP RFLEALSYYS  540
AIFESLDITL ARESKERVNV EQQCLARDIV NIIACEGIDR VERHEMMGKW RARLTMAGFR  600
PYPLSQTVNN TIKTLLESYS DKYRLKEEGG ALFLGWKNRP LIVSSAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-7128564725377Protein SCARECROW
5b3h_D3e-7128564725377Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.4620.0protonema
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024368210.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368212.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368213.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368214.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368215.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368216.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368217.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368218.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368219.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368220.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368221.10.0scarecrow-like transcription factor PAT1
RefseqXP_024368222.10.0scarecrow-like transcription factor PAT1
SwissprotQ8GVE11e-173CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
SwissprotQ8H1251e-173SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A2K1L3Q80.0A0A2K1L3Q8_PHYPA; Uncharacterized protein
STRINGPP1S456_3V6.20.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-175scarecrow-like 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]