PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_20930V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 771aa    MW: 84060.9 Da    PI: 6.5431
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_20930V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.34e-1294087681373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        lv+lL +cAeavs+g+ e a++ L++l  +as  gd mqR+aa+fte+Laar++++ + +yk l +++      ++ l+a++++++v+P+++
  Pp3c2_20930V3.3.p 408 LVNLLHDCAEAVSKGKIETATQKLEELYSHASLFGDFMQRVAAFFTEGLAARMVGKDKPMYKNLMVQSR----LDDYLSAFTTLYKVCPYFQ 495
                        6899*********************************************************99887766....79***************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        f+h++aNqaIleaveg + vHiiD+d++qGlQWp ++q+L++R++gpp+l+iTg+g     s ++l+ tg+rLa+fAe+ gvpfef++ v+ 
  Pp3c2_20930V3.3.p 496 FGHFAANQAILEAVEGRSVVHIIDMDLMQGLQWPGFIQSLSEREDGPPKLKITGIGT----SCNSLQDTGRRLASFAETYGVPFEFHA-VVG 582
                        *********************************************************....99*************************.799 PP

               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        +ledl++ eL  kpgEa+aVn+v+qlhrll++  +l++    ++  ++sl P ++++veqea+hn++sFl rf+ea++yy+a+fdsl+++lp
  Pp3c2_20930V3.3.p 583 ELEDLTPMELGAKPGEAVAVNCVMQLHRLLNNGDKLHN----FIAGLRSLHPVMLTLVEQEANHNTSSFLGRFVEAVHYYAAVFDSLDSSLP 670
                        9*****************************88888888....************************************************** PP

               GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.sgslvlgWkdrpL 367
                         +seer+k+E+ +++++i+n+vaceg +r+erhetl  W++r+ +aGF+++pls++a++qaklll+  +  gyr+ ++  gs+ l W+d+ L
  Pp3c2_20930V3.3.p 671 LASEERAKIEQLYFAQQIKNIVACEGVDRIERHETLDLWQKRMVTAGFRQLPLSSHAVTQAKLLLSLSPCGGYRLSQQpGGSISLNWQDQCL 762
                        ***************************************************************************987255555******** PP

               GRAS 368 vsvSaW 373
                        +s+S+W
  Pp3c2_20930V3.3.p 763 LSASSW 768
                        ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.914382748IPR005202Transcription factor GRAS
PfamPF035141.4E-126408768IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MMPPFGSLLE PSTDSRGGPG SFYVKPELGV DAVKKIGMDT PQSAFSSYRD AHPPLRKPLQ  60
HELSAFGPFA AQGQSSVDAS AVNVAPILPS VDAHLQLWRP TSRQPVQVKH YLQPTVLQST  120
TNNFLSKKQS TEVSQQFNGM FRSTNANAMH SKSSDVGSSG LVTGIRDTTS DGFVVVSCKQ  180
VKCKQECDIA SSSFSAPPLS RKRSHSDLAE EESCDSELVL GIGGRSSVSR GGSEFRNSRA  240
SSPRKSLKSS DTRLDLVSAD LCLAPPVLAP EYSSSSSQQE VPSSSMLEVQ PFGESSKVSH  300
SRGPYASPTE SHLSFQKIKS QDASRMEGVT CVSQAESHPT GSRCCQPVRP LLNLEAIKRE  360
CDAVERERDN EESLAQSRTH HEGVELGLFP GVFAADTGKK SETSGLQLVN LLHDCAEAVS  420
KGKIETATQK LEELYSHASL FGDFMQRVAA FFTEGLAARM VGKDKPMYKN LMVQSRLDDY  480
LSAFTTLYKV CPYFQFGHFA ANQAILEAVE GRSVVHIIDM DLMQGLQWPG FIQSLSERED  540
GPPKLKITGI GTSCNSLQDT GRRLASFAET YGVPFEFHAV VGELEDLTPM ELGAKPGEAV  600
AVNCVMQLHR LLNNGDKLHN FIAGLRSLHP VMLTLVEQEA NHNTSSFLGR FVEAVHYYAA  660
VFDSLDSSLP LASEERAKIE QLYFAQQIKN IVACEGVDRI ERHETLDLWQ KRMVTAGFRQ  720
LPLSSHAVTQ AKLLLSLSPC GGYRLSQQPG GSISLNWQDQ CLLSASSWVL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-8139976910379Protein SCARECROW
5b3h_A5e-813997689377Protein SCARECROW
5b3h_D5e-813997689377Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.70540.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024358592.10.0scarecrow-like protein 13
RefseqXP_024358593.10.0scarecrow-like protein 13
TrEMBLA0A2K1L2G80.0A0A2K1L2G8_PHYPA; Uncharacterized protein
STRINGPP1S165_77V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-89RGA-like 1