PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_18410V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 754aa    MW: 83983.8 Da    PI: 6.5063
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_18410V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS352.18.5e-1083717471374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn.......sseelaalkl 83 
                        +v+lLl+cAeav+  + + a  +Larl+ +  p+g+pm+R+a yf+eAL +rl+   + ++ ++  ++ + +e +       s e   a+++
  Pp3c2_18410V3.2.p 371 MVHLLLACAEAVDMCQSATAGPMLARLRSIYDPEGEPMRRIALYFAEALFERLTIemNRKQSSHHGSCVRFPEPEvdsaaspSLECDIAYQA 462
                        689*************************************************9863222333333355555444434466667777788899 PP

               GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                        ++++ P+ kf+hltaNqa+le v++  rvHiiDf+i qGlQWp+++q+La  p+gpp+l+ T+v+     ++ ++++tg+rLa+fA++++vp
  Pp3c2_18410V3.2.p 463 YYQILPFKKFTHLTANQALLEGVANYPRVHIIDFNIRQGLQWPSFIQSLAMLPRGPPQLKFTAVQT----DAATVQKTGNRLAEFARTMHVP 550
                        ******************************************************************....9********************* PP

               GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                        fef + +++++e+++  +++ + +EalaVn++ +lhrll+++++l++    +L  ++sl+P vv+v e +a+hn++sF+ rf++al+yy a+
  Pp3c2_18410V3.2.p 551 FEFYI-LEESVESFHQGMISPRAEEALAVNCSDMLHRLLRKEGKLTE----LLGKIRSLQPVVVTVLEVDANHNEPSFMPRFVHALHYYCAV 637
                        ****9.699******************************99999999....***************************************** PP

               GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg..yrveeesg 356
                        fdslea l r+s +r  +E+++++ +i++++a e  +r+ rh ++e+W++ + +aGF++v++s +aa+qa+lll  +k sd   +++ +  g
  Pp3c2_18410V3.2.p 638 FDSLEAALLRNSLDRLRIENHCFSTQIRSIIALEDVDREIRHVRAETWQSHFLQAGFRAVTVSRYAADQAQLLLGLYKpSDRmpFTLSSGFG 729
                        ******************************************************************************9887789999999* PP

               GRAS 357 slvlgWkdrpLvsvSaWr 374
                         l lgW++ p+v+vS+W+
  Pp3c2_18410V3.2.p 730 GLSLGWRETPVVAVSSWT 747
                        *****************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.714345724IPR005202Transcription factor GRAS
PfamPF035142.9E-105371747IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MAEITHYRPH SDTNTVKFAT VPDLQTYLGI SSWLELNQHW RLGDATKFFK VAEHEGQNSM  60
SSAVDSKRLD SGKSGNQHST ALAMSKEPTS VLDLPSSCSV SLSSQHSMNS VSDGISKALQ  120
TVADQLLSDE QDSAHPMQSA TPETSNMLMD QDVMTWMSLT RGSDHSASDM DPVPDWFHKQ  180
PERLDLNAQQ YYCSKTGLDF HKNPGTMERI CNNLPSSHHH YVAQPFKLIS QAQLTMSETA  240
GNQQTGFFDT STSSNQRAFQ QCRNVKAQGA TLMSMIDGTG AITGSQLLNS TVVPTPELWK  300
LLSSQHDASP QCGNQGPPNK QAPITQARDQ QNRSTSLAIP TQQPQPQLPY HFGQTLYPGV  360
TPQDQETGIH MVHLLLACAE AVDMCQSATA GPMLARLRSI YDPEGEPMRR IALYFAEALF  420
ERLTIEMNRK QSSHHGSCVR FPEPEVDSAA SPSLECDIAY QAYYQILPFK KFTHLTANQA  480
LLEGVANYPR VHIIDFNIRQ GLQWPSFIQS LAMLPRGPPQ LKFTAVQTDA ATVQKTGNRL  540
AEFARTMHVP FEFYILEESV ESFHQGMISP RAEEALAVNC SDMLHRLLRK EGKLTELLGK  600
IRSLQPVVVT VLEVDANHNE PSFMPRFVHA LHYYCAVFDS LEAALLRNSL DRLRIENHCF  660
STQIRSIIAL EDVDREIRHV RAETWQSHFL QAGFRAVTVS RYAADQAQLL LGLYKPSDRM  720
PFTLSSGFGG LSLGWRETPV VAVSSWTFSP PPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-6436374712379Protein SCARECROW
5b3h_A4e-6436374711378Protein SCARECROW
5b3h_D4e-6436374711378Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024358430.10.0DELLA protein DWARF8-like
TrEMBLA0A2K1L2280.0A0A2K1L228_PHYPA; Uncharacterized protein
STRINGPP1S281_32V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-71RGA-like 2