PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_11380V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 775aa    MW: 86222.8 Da    PI: 5.56
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_11380V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS382.55e-1173997672373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cA+av++ d + a++l+ +l++++s +g+  qR+a+yf+eAL a++++++ +ly+al+  + s   +++ l+a+ lf e +P++++
  Pp3c2_11380V3.3.p 399 TDLLIRCAQAVEQADYRHANELIHELRHHSSAYGNGSQRMAHYFMEALVAKISGTGGQLYSALSNYRPS---EAQMLKAQMLFCEHCPFIQV 487
                        689************************************************************888888...8999**************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                         h+ aN+aI+ a++g+ rvHiiD++i +G+QWp+L+++L++Rpegpp+lRiTg+++p++g   + +++ tg+rLak+A+++gvpfef++ +a
  Pp3c2_11380V3.3.p 488 PHIYANHAIMVAFKGAPRVHIIDYGILYGIQWPCLIHQLSQRPEGPPHLRITGIDRPQPGfrPSARIQDTGRRLAKLAKQMGVPFEFHA-IA 578
                        *************************************************************9***************************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++e++++ +L ++ +E+laVn++++  +lldesv+ +s+r+ vL+ ++sl+Pk++v    +a +n++ F+ rf eal y+s++fds+e ++
  Pp3c2_11380V3.3.p 579 EKWEAITPAHLLLRDDEVLAVNSMFRFRHLLDESVTAASPRNLVLSRIRSLNPKIFVQGVLNAGYNAPFFMSRFREALAYFSTIFDSMECSF 670
                        ******************************************************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        p+e+ +r+ +++e++grei nvvaceg er+er et+++W++r ++aGF++ p s ++++++++ +r ++ d y + e+ ++++lgWk+r  
  Pp3c2_11380V3.3.p 671 PAEHPDRQIIDHEIVGREILNVVACEGPERVERSETYRQWQARTMRAGFQQKPNSPDVMAKIRMAMRSYHRD-YGIGEDGAWFLLGWKERIT 761
                        **********************************************************************66.******************* PP

               GRAS 368 vsvSaW 373
                         ++++W
  Pp3c2_11380V3.3.p 762 HAMTVW 767
                        ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.234372749IPR005202Transcription factor GRAS
PfamPF035141.7E-114399767IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MAGSKHERSG DSPVGTGEVS PLAAQLQQAW LQTQMPKAQK RSFTSVANAQ NQLPRLSPPG  60
PGSEMSASSK PPSSSVLKSL STLFPELANV QEKKEAKISS VFEEGEQPIP IHPELRQKKA  120
ECLEVMFGQD VVEQTQAQGL RDYDRHASTE RSLSDSLIQQ SDDSLDFSDL GPLSVSNSFS  180
RPSAQPGRGT FEDDLSYICS AYGSRPSASE YETSAEVEQE KTPLFEYLTD ILMDENVEEK  240
KCMFIEMSAY QAMAKELGDL ISYDPPPMPI PETRRSDPHF EEDVRFVDSW IDEILSGPLP  300
ADRTDSPGAE AKLDIKHGSS PEELYSHTDA DRGSSVWNDT ASDTASYLHP DSTLSPVDFG  360
NSHALENGSG GSLQVGTRHL SSISSSNGNG VHAPPVDLTD LLIRCAQAVE QADYRHANEL  420
IHELRHHSSA YGNGSQRMAH YFMEALVAKI SGTGGQLYSA LSNYRPSEAQ MLKAQMLFCE  480
HCPFIQVPHI YANHAIMVAF KGAPRVHIID YGILYGIQWP CLIHQLSQRP EGPPHLRITG  540
IDRPQPGFRP SARIQDTGRR LAKLAKQMGV PFEFHAIAEK WEAITPAHLL LRDDEVLAVN  600
SMFRFRHLLD ESVTAASPRN LVLSRIRSLN PKIFVQGVLN AGYNAPFFMS RFREALAYFS  660
TIFDSMECSF PAEHPDRQII DHEIVGREIL NVVACEGPER VERSETYRQW QARTMRAGFQ  720
QKPNSPDVMA KIRMAMRSYH RDYGIGEDGA WFLLGWKERI THAMTVWEPL PDSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-5540476924379Protein SCARECROW
5b3h_D3e-5540476924379Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.176960.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401598.10.0scarecrow-like protein 30
RefseqXP_024401607.10.0scarecrow-like protein 30
RefseqXP_024401617.10.0scarecrow-like protein 30
TrEMBLA0A2K1L1440.0A0A2K1L144_PHYPA; Uncharacterized protein
STRINGPP1S84_299V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-134SCARECROW-like 14