PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_10790V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 759aa    MW: 83341.9 Da    PI: 6.2683
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_10790V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.6e-2170125156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t+ q++e+e lF+++++p+ ++r++L+k lgL+ rqVk+WFqNrR+ +k
  Pp3c2_10790V3.2.p  70 KKRYHRHTPRQIQEMEMLFKECPHPDDKQRQQLSKDLGLEPRQVKFWFQNRRTHMK 125
                        688999**********************************************9988 PP

2START211.14.1e-662684902206
                        HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        la  a++elv++a++eep+Wv+ +    e++n+de+l++ +++ +      ++e+ r++++v m+ ++lve+l+d   qW  +++    +a 
  Pp3c2_10790V3.2.p 268 LAMMAMEELVRMAQSEEPLWVRTPesgrEQLNYDEYLRQSPRGIGmkppgLKTEVTRETAMVMMNGVNLVETLMDAT-QWIDMYPcmvsRAL 358
                        566799************************************999********************************.************** PP

                        EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        t++v+s+g      galqlm+aelq+lsplvp R+ +f+Ry++q+ +g+w++vdvSv+s +++p  +s++R++++pSgili++++ng+ kvt
  Pp3c2_10790V3.2.p 359 TVDVLSTGvagnrnGALQLMYAELQVLSPLVPtREIYFLRYCKQHAEGVWAVVDVSVESLRDNP-PPSLMRCRRRPSGILIQDTPNGYAKVT 449
                        ****************************************************************.7************************** PP

                        EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         veh+++++r +h ++r lv+sg+a+ga++w+atlqrqce+
  Pp3c2_10790V3.2.p 450 CVEHMEYDDRAVHRMYRELVNSGMAFGAQRWMATLQRQCER 490
                        ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.0E-1952127IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-2254108IPR009057Homeodomain-like
PROSITE profilePS5007116.90867127IPR001356Homeobox domain
SMARTSM003897.3E-2068131IPR001356Homeobox domain
PfamPF000464.6E-1970125IPR001356Homeobox domain
CDDcd000866.81E-1970127No hitNo description
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.602.5E-4109155IPR009057Homeodomain-like
PROSITE profilePS5084847.171258493IPR002913START domain
SuperFamilySSF559613.75E-37259492No hitNo description
CDDcd088751.24E-128262489No hitNo description
SMARTSM002341.9E-60267490IPR002913START domain
PfamPF018527.2E-56269490IPR002913START domain
Gene3DG3DSA:3.30.530.206.5E-6364490IPR023393START-like domain
SuperFamilySSF559611.92E-24513750No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MSRPPPKLYT SPALSLAPPT GVDRQREASQ TAESEQQQKN KEEEYGSRSG SDNMEGGSDD  60
DQDPDRPPRK KRYHRHTPRQ IQEMEMLFKE CPHPDDKQRQ QLSKDLGLEP RQVKFWFQNR  120
RTHMKAQTER AENSMLRAEN EKLRSENVIM REALKNPQCP HCGGPATVGE MSFDEQQLRL  180
ENVRLKEELD RVSALAAKYL GRPIPPMAPL ALPSSSLDLQ VGAGGSSFGG LHPAQAGNLS  240
MVQGPSVADV ATRPGGLTEA EKPMVVELAM MAMEELVRMA QSEEPLWVRT PESGREQLNY  300
DEYLRQSPRG IGMKPPGLKT EVTRETAMVM MNGVNLVETL MDATQWIDMY PCMVSRALTV  360
DVLSTGVAGN RNGALQLMYA ELQVLSPLVP TREIYFLRYC KQHAEGVWAV VDVSVESLRD  420
NPPPSLMRCR RRPSGILIQD TPNGYAKVTC VEHMEYDDRA VHRMYRELVN SGMAFGAQRW  480
MATLQRQCER LASLLASNIA SRDLGGVPSA NGRRSMLKLA QRMTNNFCAG VSASTVHTWT  540
TLSGSGDDDV RVMTRKSVDN PGEPHGIVLS AATSMWLPVS PARVFQFLRD ERLRSEWDIL  600
SNGGMVTEMA HIAKGQDPGN SVSLLKVNAM NTNNSNMLIL QESCTDVSGS LVIYAPVDIP  660
AMNLVLQGGD PAYVALLPSG FAILPDGPGG GDRVYMGEQP GQLTESGRGS GSLLTVAFQI  720
LVSSVPSARL SLESVATVNN LISCTVQRIK AALLVDDA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024368074.10.0homeobox-leucine zipper protein HDG2-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLQ147S50.0Q147S5_PHYPA; Class IV HD-Zip protein HDZ42
STRINGPP1S84_236V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Prigge MJ,Clark SE
    Evolution of the class III HD-Zip gene family in land plants.
    Evol. Dev., 2006 Jul-Aug. 8(4): p. 350-61
    [PMID:16805899]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]