PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_10790V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 795aa    MW: 86984.2 Da    PI: 6.5216
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_10790V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.51.7e-21106161156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t+ q++e+e lF+++++p+ ++r++L+k lgL+ rqVk+WFqNrR+ +k
  Pp3c2_10790V3.1.p 106 KKRYHRHTPRQIQEMEMLFKECPHPDDKQRQQLSKDLGLEPRQVKFWFQNRRTHMK 161
                        688999**********************************************9988 PP

2START2114.5e-663045262206
                        HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        la  a++elv++a++eep+Wv+ +    e++n+de+l++ +++ +      ++e+ r++++v m+ ++lve+l+d   qW  +++    +a 
  Pp3c2_10790V3.1.p 304 LAMMAMEELVRMAQSEEPLWVRTPesgrEQLNYDEYLRQSPRGIGmkppgLKTEVTRETAMVMMNGVNLVETLMDAT-QWIDMYPcmvsRAL 394
                        566799************************************999********************************.************** PP

                        EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        t++v+s+g      galqlm+aelq+lsplvp R+ +f+Ry++q+ +g+w++vdvSv+s +++p  +s++R++++pSgili++++ng+ kvt
  Pp3c2_10790V3.1.p 395 TVDVLSTGvagnrnGALQLMYAELQVLSPLVPtREIYFLRYCKQHAEGVWAVVDVSVESLRDNP-PPSLMRCRRRPSGILIQDTPNGYAKVT 485
                        ****************************************************************.7************************** PP

                        EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         veh+++++r +h ++r lv+sg+a+ga++w+atlqrqce+
  Pp3c2_10790V3.1.p 486 CVEHMEYDDRAVHRMYRELVNSGMAFGAQRWMATLQRQCER 526
                        ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-1988163IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-2290144IPR009057Homeodomain-like
PROSITE profilePS5007116.908103163IPR001356Homeobox domain
SMARTSM003897.3E-20104167IPR001356Homeobox domain
PfamPF000464.9E-19106161IPR001356Homeobox domain
CDDcd000866.11E-19106163No hitNo description
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.602.7E-4145191IPR009057Homeodomain-like
PROSITE profilePS5084847.171294529IPR002913START domain
SuperFamilySSF559614.03E-37295528No hitNo description
CDDcd088752.46E-128298525No hitNo description
SMARTSM002341.9E-60303526IPR002913START domain
PfamPF018527.8E-56305526IPR002913START domain
Gene3DG3DSA:3.30.530.207.0E-6400526IPR023393START-like domain
SuperFamilySSF559612.2E-24549786No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MRLGGVTVQV TPNGNLGGRC FGELGGMAPP RPIPPLMSRP PPKLYTSPAL SLAPPTGVDR  60
QREASQTAES EQQQKNKEEE YGSRSGSDNM EGGSDDDQDP DRPPRKKRYH RHTPRQIQEM  120
EMLFKECPHP DDKQRQQLSK DLGLEPRQVK FWFQNRRTHM KAQTERAENS MLRAENEKLR  180
SENVIMREAL KNPQCPHCGG PATVGEMSFD EQQLRLENVR LKEELDRVSA LAAKYLGRPI  240
PPMAPLALPS SSLDLQVGAG GSSFGGLHPA QAGNLSMVQG PSVADVATRP GGLTEAEKPM  300
VVELAMMAME ELVRMAQSEE PLWVRTPESG REQLNYDEYL RQSPRGIGMK PPGLKTEVTR  360
ETAMVMMNGV NLVETLMDAT QWIDMYPCMV SRALTVDVLS TGVAGNRNGA LQLMYAELQV  420
LSPLVPTREI YFLRYCKQHA EGVWAVVDVS VESLRDNPPP SLMRCRRRPS GILIQDTPNG  480
YAKVTCVEHM EYDDRAVHRM YRELVNSGMA FGAQRWMATL QRQCERLASL LASNIASRDL  540
GGVPSANGRR SMLKLAQRMT NNFCAGVSAS TVHTWTTLSG SGDDDVRVMT RKSVDNPGEP  600
HGIVLSAATS MWLPVSPARV FQFLRDERLR SEWDILSNGG MVTEMAHIAK GQDPGNSVSL  660
LKVNAMNTNN SNMLILQESC TDVSGSLVIY APVDIPAMNL VLQGGDPAYV ALLPSGFAIL  720
PDGPGGGDRV YMGEQPGQLT ESGRGSGSLL TVAFQILVSS VPSARLSLES VATVNNLISC  780
TVQRIKAALL VDDA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024368074.10.0homeobox-leucine zipper protein HDG2-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLQ147S50.0Q147S5_PHYPA; Class IV HD-Zip protein HDZ42
STRINGPP1S84_236V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Prigge MJ,Clark SE
    Evolution of the class III HD-Zip gene family in land plants.
    Evol. Dev., 2006 Jul-Aug. 8(4): p. 350-61
    [PMID:16805899]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]