PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c27_60V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family ARF
Protein Properties Length: 753aa    MW: 83436.3 Da    PI: 6.5529
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c27_60V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B384.11.3e-26134235199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d++g++W++++iyr++++r++lt+GW+ Fv+a++L +gD+v+F   + +
  Pp3c27_60V3.3.p 134 FCKTLTASDTSTHGGFSVPRRSAEDClplldyNMNPPCQ-ELVAKDLHGQEWKFRHIYRGYPRRHLLTTGWSTFVSAKKLVAGDTVIFL--RGE 224
                      99******************************8888886.9************************************************..448 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      +++l+v+v+r+
  Pp3c27_60V3.3.p 225 NGQLRVGVRRA 235
                      9999*****97 PP

2Auxin_resp107.31.8e-35260342183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha ++++ F+v+YnPr+s+seFv++++k++ka++ +++vG+Rf+m+fe+e+ss rr++Gt++ v+d+dp+rWpnS Wrs+k
  Pp3c27_60V3.3.p 260 ASHASREGMRFSVIYNPRTSPSEFVIPYHKFLKAMDYNLAVGSRFRMKFESEESSGRRYAGTITEVNDADPLRWPNSLWRSMK 342
                      6799999*************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-39126246IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.8E-42128246IPR015300DNA-binding pseudobarrel domain
CDDcd100171.23E-24132234No hitNo description
PROSITE profilePS5086313.733134236IPR003340B3 DNA binding domain
SMARTSM010191.9E-24134236IPR003340B3 DNA binding domain
PfamPF023622.1E-23134235IPR003340B3 DNA binding domain
PfamPF065072.9E-31260342IPR010525Auxin response factor
PfamPF023097.6E-9646734IPR033389AUX/IAA domain
PROSITE profilePS5174524.028648731IPR000270PB1 domain
SuperFamilySSF542771.11E-8651726No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MYGYGGGMMR GPMMNQGLSK IDDLDYELWH ACAGPLTSLP PVDSLVIYWP QGHIEQVIAC  60
TPDSAGAADV REASSHFKLP SHLLCRIGQL ELQADPNTDE VFAQMDLLPQ DEGSVTKEMK  120
EAPSAIKQSS VKMFCKTLTA SDTSTHGGFS VPRRSAEDCL PLLDYNMNPP CQELVAKDLH  180
GQEWKFRHIY RGYPRRHLLT TGWSTFVSAK KLVAGDTVIF LRGENGQLRV GVRRASKQQP  240
QAHSTYFSST NLHLGVLAAA SHASREGMRF SVIYNPRTSP SEFVIPYHKF LKAMDYNLAV  300
GSRFRMKFES EESSGRRYAG TITEVNDADP LRWPNSLWRS MKVEWDEVIS ASDRHERVSP  360
WEIEPFVPIS TLPPPLGGAR QKRRSPTLVK DPLLGTSQSV LDSYQSNKLF KVLQGFDSRN  420
EFSMEDEEDE DVVCSRNTSW NVKPEPPPKT VPQAMPAQQS WFPRADMPSF GVPVAPHQPL  480
ISPRVPSENM NLQLSVNPAS SEQAPGNDHS SASWSDFSGG CLNFNWLYNA STPRPVFERS  540
NLPTTSLNNE SASKMLPPQV IPPFEARDKV ELVKLRTTPA LVQPCKLFGF DLADKKVPSS  600
VTLAPSHGEV SEVTVELLRT DLTSGGHLGN KLTAESCQAT QAHVTPMRSG IKVYQPGKVG  660
RTIDLKKCES YTGLRRVLAN LFNLQGQLDD VTKGWQLVYT DHENDVLLVG DDPWEEFCGC  720
VRSLKILSPQ DVAGQSVGKF PTSSCENDDG RQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1192236617355Auxin response factor 1
4ldw_A1e-1192236617355Auxin response factor 1
4ldw_B1e-1192236617355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.58000.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024367460.10.0auxin response factor 25-like
RefseqXP_024367461.10.0auxin response factor 25-like
RefseqXP_024367462.10.0auxin response factor 25-like
RefseqXP_024367463.10.0auxin response factor 25-like
TrEMBLA0A2K1IA280.0A0A2K1IA28_PHYPA; Auxin response factor
STRINGPP1S280_7V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-130auxin response factor 2