PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c26_4660V3.15.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 390aa    MW: 43551.9 Da    PI: 6.3225
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c26_4660V3.15.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.91.3e-55201471128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv++yL++k+++ ++++ ++i evd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWkatgkdk+
  Pp3c26_4660V3.15.p  20 LPPGFRFHPTDEELVSYYLTRKIRNPDFSV-RAIGEVDLNKCEPWDLPVKATFGEKEWYFFSLRDRKYPTGLRTNRATEKGYWKATGKDKD 109
                         79****************************.89***************888889************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vl++ +++lvg+kktLvfy+grapkgekt+W+mheyr+
  Pp3c26_4660V3.15.p 110 VLRSgDHSLVGMKKTLVFYRGRAPKGEKTSWIMHEYRV 147
                         **9967778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6415175IPR003441NAC domain
PROSITE profilePS5100560.50320174IPR003441NAC domain
PfamPF023656.7E-2921147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MATMCVGKNS LEMQGSNMEL PPGFRFHPTD EELVSYYLTR KIRNPDFSVR AIGEVDLNKC  60
EPWDLPVKAT FGEKEWYFFS LRDRKYPTGL RTNRATEKGY WKATGKDKDV LRSGDHSLVG  120
MKKTLVFYRG RAPKGEKTSW IMHEYRVESD SSNQTNQELP RSKDEWVVCR VFYKNGGGRH  180
KYVLHSGLDS LPNNSDSAIP GHLESSPNPS VNEDGDCDTR VKGAEREVTW MGGPKLGVSI  240
TPTRLKSIAA SSPDTNISLY NQNPNFLDFG ISPHGAMSNM TSLKSFNRNG NRMRLKDEPY  300
YACEGEDGAQ TNQGLGLDYS WCGGVIYQDM SLEGPIAPFL SLTAEIDCIT ESFSEEQQAR  360
PPSRIRSLSG VPEIHGPMDT LQEIITSTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-571617913170NAC domain-containing protein 19
4dul_A9e-571617913170NAC domain-containing protein 19
1ut7_B9e-571617913170NO APICAL MERISTEM PROTEIN
1ut7_A9e-571617913170NO APICAL MERISTEM PROTEIN
1ut4_B9e-571617913170NO APICAL MERISTEM PROTEIN
1ut4_A9e-571617913170NO APICAL MERISTEM PROTEIN
3swp_D1e-561617916173NAC domain-containing protein 19
3swp_C1e-561617916173NAC domain-containing protein 19
3swp_B1e-561617916173NAC domain-containing protein 19
3swp_A1e-561617916173NAC domain-containing protein 19
3swm_D1e-561617916173NAC domain-containing protein 19
3swm_C1e-561617916173NAC domain-containing protein 19
3swm_B1e-561617916173NAC domain-containing protein 19
3swm_A1e-561617916173NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S159_57V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.23e-79NAC domain containing protein 80