PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c26_1490V3.1.p
Common NamePpDof2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 498aa    MW: 53164.1 Da    PI: 8.1076
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c26_1490V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.5e-37153211260
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++k ++cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG+lrnv vG+grrknk 
  Pp3c26_1490V3.1.p 153 PDKLIPCPRCDSLETKFCYYNNYNVNQPRHFCKSCQRYWTAGGTLRNVLVGAGRRKNKY 211
                        78999****************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-28151210IPR003851Zinc finger, Dof-type
PfamPF027011.2E-30155210IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.624157211IPR003851Zinc finger, Dof-type
PROSITE patternPS013610159195IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MSKLRKWMMK EDRESSAGSA DTSAIKLFGA TIAVSITDSG VSSKAATSMN ATVAKPCVSL  60
TGSEEVDGAS MQLEADEMGS SLGSTCNESS AGALNTSNAE MAIKDVNGEA QVFATFTREL  120
PQSVMQTIHG MVSQQKQRAL TVEEKKEQCS KKPDKLIPCP RCDSLETKFC YYNNYNVNQP  180
RHFCKSCQRY WTAGGTLRNV LVGAGRRKNK YGASQMKQED AEGANSGITT VRMDHHEGAQ  240
PMLPCTINPY VIKVPPMQLP QLATQCSPRQ VSDVQSTVTT SCKAVSSASA FQPAVPEMST  300
DSVSKLRQRS GTESTFEGKE TSSSISSVSA TETTSKYVLS SRVPPQQQAD QQAVWTKNSV  360
PLGYFNGAWP YGYNIGIGGV GPIPDNPAMC GPHPAAALAS SNLPNGMSPP PVNVWTGMWA  420
SGMPSGMPGM AGVPAVPFGW NVCQGGWTLP WRPVPAVAVQ PPAEVMHSGS ARKWDSASSE  480
DRVRKMARVE IPEKDVL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.127110.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6266980.0AB626698.1 Physcomitrella patens PpDof2 mRNA for Dof transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024367108.10.0uncharacterized protein LOC112278168
TrEMBLH1ACS90.0H1ACS9_PHYPA; Dof transcription factor
STRINGPP1S149_180V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-35cycling DOF factor 1
Publications ? help Back to Top
  1. Sugiyama T, et al.
    Involvement of PpDof1 transcriptional repressor in the nutrient condition-dependent growth control of protonemal filaments in Physcomitrella patens.
    J. Exp. Bot., 2012. 63(8): p. 3185-97
    [PMID:22345635]