PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c25_13450V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 348aa    MW: 38624.2 Da    PI: 4.4082
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c25_13450V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-1885138356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q++ Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Pp3c25_13450V3.2.p  85 KKRRLTFDQVRSLEKNFEIENKLEPERKMQLANELGLQPRQVAVWFQNRRARWK 138
                         5668999**********************************************9 PP

2HD-ZIP_I/II121.93.2e-3985175292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkrrl+ +qv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L   y++lk+e e++ +e++eL++e++
  Pp3c25_13450V3.2.p  85 KKRRLTFDQVRSLEKNFEIENKLEPERKMQLANELGLQPRQVAVWFQNRRARWKTKQLERDYEVLTLDYNRLKSEFEAVLQEKQELQDEME 175
                         9**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575133No hitNo description
Gene3DG3DSA:1.10.10.605.9E-2066141IPR009057Homeodomain-like
SuperFamilySSF466891.38E-1979142IPR009057Homeodomain-like
PROSITE profilePS5007117.15180140IPR001356Homeobox domain
SMARTSM003892.7E-1583144IPR001356Homeobox domain
CDDcd000864.19E-1785141No hitNo description
PfamPF000469.3E-1685138IPR001356Homeobox domain
PRINTSPR000311.2E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5120136IPR000047Helix-turn-helix motif
PfamPF021834.1E-14140182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MANNGRGCVG GSNVMHVRND SSGSSLVAML ASCSPAAAVQ AQPGGGGMED TVSCGQKRPY  60
YSTIEASGED PGEEDVGDDC IQQSKKRRLT FDQVRSLEKN FEIENKLEPE RKMQLANELG  120
LQPRQVAVWF QNRRARWKTK QLERDYEVLT LDYNRLKSEF EAVLQEKQEL QDEMECLTEK  180
IQTAIPNSAD PILEKRKRII SMSQPSSLKT FEGPVKSERI AAEVNGRNDA LTPCKEEGSK  240
EEGSKETSSD SISSEILNAD SPRTMDSGSL LPLPDSMSTF SHVCTEMVDS NIIHMSDQLC  300
DQMLSPQACQ LVSVKIEDGS YQDDSCNYIL TLMDSIEEKG LPWWDFP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1620.0gametophore
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280720.0AB028072.1 Physcomitrella patens mRNA for homeobox protein PpHB1, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024388198.11e-140homeobox-leucine zipper protein HAT5-like
TrEMBLA0A2K1IER30.0A0A2K1IER3_PHYPA; Uncharacterized protein
STRINGPP1S4_70V6.11e-157(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-39homeobox 1