PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c24_6560V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 288aa    MW: 32102.9 Da    PI: 6.9186
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c24_6560V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.34.7e-42111111101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC++dC+l+pyfp +qpk+fanvhklFG+sn+l++lk +++++red+++s++yeA+ r +dPv+G++gvi+ lq+q+++lk+
  Pp3c24_6560V3.2.p  11 ACAACKFQRRKCSADCPLSPYFPPDQPKRFANVHKLFGVSNILRILKFVDPSKREDTVKSIAYEADTREKDPVHGCLGVITVLQNQVSKLKE 102
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        el++++e+l
  Pp3c24_6560V3.2.p 103 ELNMAGEQL 111
                        ***999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97310111IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4011107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MTGSTGNTNT ACAACKFQRR KCSADCPLSP YFPPDQPKRF ANVHKLFGVS NILRILKFVD  60
PSKREDTVKS IAYEADTREK DPVHGCLGVI TVLQNQVSKL KEELNMAGEQ LFLVEQQQAV  120
ASAGQQLQSF HGHPGLSRSS VSEDEESQFL RHQISFHDDH KFDTKFNQKS NILPLNYRYG  180
ADDASSVISL LNVDHVEQLR RAGSYFGMDP SYDESPVSHH QMHMQAVLEQ DHFHALRSSP  240
PDGLSAYGIA PEGVMRRTNY LVTSGQCKVS DHDLQRAGVY LTLTNQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3841124112LOB family transfactor Ramosa2.1
5ly0_B2e-3841124112LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024363798.10.0uncharacterized protein LOC112276598 isoform X1
RefseqXP_024363799.10.0uncharacterized protein LOC112276598 isoform X1
RefseqXP_024363800.10.0uncharacterized protein LOC112276598 isoform X2
RefseqXP_024363801.10.0uncharacterized protein LOC112276598 isoform X2
RefseqXP_024363802.10.0uncharacterized protein LOC112276598 isoform X2
RefseqXP_024363803.10.0uncharacterized protein LOC112276598 isoform X2
TrEMBLA0A2K1IFT10.0A0A2K1IFT1_PHYPA; Uncharacterized protein
STRINGPP1S73_7V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-42LOB domain-containing protein 25