PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c24_12920V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 185aa    MW: 21304.3 Da    PI: 4.9886
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c24_12920V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS98.11.3e-3069167274373
                GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                          +pr+  +r +vE+ +++++i+n+va e a+r+erhe+le+W++ +++aGF++vpls++a++qa  ll ++ ++ + +    g++ l+W++
  Pp3c24_12920V3.1.p  69 AMPRDCPDRLNVEKNYFAKQIENIVAFEDADRTERHESLEQWSKIMQTAGFSTVPLSHYAYSQAVQLLWQFCDR-FWLRRLAGCISLTWQN 158
                         689999******************************************************************66.**************** PP

                GRAS 365 rpLvsvSaW 373
                         r+L++vSaW
  Pp3c24_12920V3.1.p 159 RSLITVSAW 167
                         ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098514.4181149IPR005202Transcription factor GRAS
PfamPF035144.4E-2869167IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MEDFTPELLQ LNPDEKVVAN FMPQLHQMLE EEGTTSILRL LKSVACLAPT LAPSQNTTLP  60
STGPNSDPAM PRDCPDRLNV EKNYFAKQIE NIVAFEDADR TERHESLEQW SKIMQTAGFS  120
TVPLSHYAYS QAVQLLWQFC DRFWLRRLAG CISLTWQNRS LITVSAWNYS KVRWFWNLVF  180
VDIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2211168197375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024363840.16e-81SCARECROW-LIKE protein 7-like
TrEMBLA0A2K1IGK91e-135A0A2K1IGK9_PHYPA; Uncharacterized protein
STRINGPP1S16_402V6.12e-73(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-24scarecrow-like 3