PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c23_7470V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 322aa    MW: 35336.4 Da    PI: 6.9946
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c23_7470V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-42131121100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC++dC+l+pyfp +qpk+f+nvhklFG+sn+l++lk++++++red+++s++yeA+ r +dPv+G++gv + lq+q+++lk 
  Pp3c23_7470V3.2.p  13 ACAACKYQRRKCSPDCPLSPYFPPDQPKRFQNVHKLFGVSNILRILKHVDPSKREDTVKSIIYEADTREKDPVHGCLGVTTILQNQVSKLKD 104
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        ela+++e+
  Pp3c23_7470V3.2.p 105 ELAVAREQ 112
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0312113IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-4113110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSGSSGSSGT NAACAACKYQ RRKCSPDCPL SPYFPPDQPK RFQNVHKLFG VSNILRILKH  60
VDPSKREDTV KSIIYEADTR EKDPVHGCLG VTTILQNQVS KLKDELAVAR EQMYLLQQQH  120
TFNQQARMEQ IVGSLGASSS VVDVSSGQEA NVLMHHSQQY SDMNQLNSDF TKSNPLSVSS  180
FEPDQYLRND GFDQIKLSSA STSTFDVSRY IRGESLVQQS ALLGQVKLDE GSVQYRAPIY  240
GMADVGSSFI STPSDDNLTQ HVDCAFNTPD PYAMAIRRRG SGFLNLTATS EAELKRSTGS  300
HGGVPEHELR RAGVYLTLTN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3771135111LOB family transfactor Ramosa2.1
5ly0_B2e-3771135111LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024362031.10.0protein IAL1-like
TrEMBLA0A2K1IID10.0A0A2K1IID1_PHYPA; Uncharacterized protein
STRINGPP1S10_271V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-38LOB domain-containing protein 25