PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c23_14630V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 190aa    MW: 20383.6 Da    PI: 7.7883
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c23_14630V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.54.2e-42111111101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da+sslvyeA+ar+rdPvyG++g i++lqqq + l+
  Pp3c23_14630V3.4.p  11 PCAACKLLRRRCAQECPFSPYFSPHEPQKFACVHKIFGASNVSKMLMEVPENQRADAASSLVYEANARIRDPVYGCMGAISALQQQAQALQ 101
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         ael+++++e+
  Pp3c23_14630V3.4.p 102 AELSAVRQEI 111
                         ******9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.45410111IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4211108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MLSSQGQGST PCAACKLLRR RCAQECPFSP YFSPHEPQKF ACVHKIFGAS NVSKMLMEVP  60
ENQRADAASS LVYEANARIR DPVYGCMGAI SALQQQAQAL QAELSAVRQE ITRYRQHDSS  120
PTDSAPATTT TSASALVSGY QKQVRERGST SDTQSSKPST SEVYTTVQSP SSTVATSESN  180
DAPYWSSIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4731144114LOB family transfactor Ramosa2.1
5ly0_B5e-4731144114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.134040.0gametophore| protonema
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots and at low levels in flowers, but not in leaves or inflorescence stems. {ECO:0000269|PubMed:12068116}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024362454.11e-137LOB domain-containing protein 15-like
SwissprotQ9AT612e-60LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A2K1IJC41e-136A0A2K1IJC4_PHYPA; Uncharacterized protein
STRINGPP1S156_26V6.11e-137(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-56LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]