PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_7230V3.1.p
Common NameDELLAb, GAL1, PHYPADRAFT_235432
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 553aa    MW: 60630.5 Da    PI: 5.9302
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_7230V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS434.76.9e-1331835501374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets.eknsseelaalklfsevsPil 91 
                        lv+ Ll+cAe ++ g+l+la+++L r++ l+ p g pm ++a++f  AL  r+++     +++ +   ++ +++ se l++   f+e++P+l
  Pp3c22_7230V3.1.p 183 LVHSLLACAESIQRGNLNLAEQTLRRIQLLSLPPG-PMGKVATHFIDALTCRIYG---VAFSSGNNVGSNqSDSLSELLHF--HFYETCPYL 268
                        689************************99988876.9******************...33333333333303345666555..4******** PP

               GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                        kf+h+taNqaIlea++g+++vH+iDf++++GlQWpaL+qaLa Rp+gpp+lR+Tg+g+p+sg ++ l+e+g +La++Ae+++v+fef+ +va
  Pp3c22_7230V3.1.p 269 KFAHFTANQAILEAFAGQKQVHVIDFNLMHGLQWPALIQALALRPGGPPRLRLTGIGPPQSGGSDVLQEIGMKLAQLAETVKVEFEFRGVVA 360
                        ******************************************************************************************** PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eak 274
                         +l+d+++++L++ +gEa+aVn+v+qlh+ll + +s+   +devL+  + l+Pk++++ve+ea+hn++sFl rf+eal+yys++fdsl + +
  Pp3c22_7230V3.1.p 361 VKLDDIKPWMLQICHGEAVAVNSVFQLHKLLYSAGSVIP-IDEVLRSARALKPKIFTIVEHEANHNQPSFLGRFTEALHYYSTMFDSLeACS 451
                        *******************************88888887.************************************************5567 PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        lp++s+e+ ++ +++lgrei n+vace a+r+erhe+l +W++r+ +aG++p++l+ +a kqa++ll ++++dgyrvee+ g+l+lgW++rp
  Pp3c22_7230V3.1.p 452 LPSDSSEQ-VLAEMYLGREINNIVACEDAARVERHENLVQWQMRMLKAGYRPIQLGLNAFKQASMLLTMFSGDGYRVEEKLGCLTLGWHTRP 542
                        77776665.556667***************************************************************************** PP

               GRAS 367 LvsvSaWr 374
                        L+s+SaW+
  Pp3c22_7230V3.1.p 543 LISASAWQ 550
                        *******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.822157530IPR005202Transcription factor GRAS
PfamPF035142.4E-130183550IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016874Molecular Functionligase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MAYQYYPGST RYEATGGALV DGQFRHANFM QPSDLVQHLE QLHSVLGTVS QDSPNIPAHH  60
TLDAGAQTSN NRTSDLAGWI DGMIDELSFN NAGTMAAPQQ RSLTEDSLHQ NELEASSSHD  120
SSLDTGSSRL PTLHYQNTPA VGNNFLATPQ NDASQLNANR ATGAVLEQQP SPMGEDEDNG  180
VRLVHSLLAC AESIQRGNLN LAEQTLRRIQ LLSLPPGPMG KVATHFIDAL TCRIYGVAFS  240
SGNNVGSNQS DSLSELLHFH FYETCPYLKF AHFTANQAIL EAFAGQKQVH VIDFNLMHGL  300
QWPALIQALA LRPGGPPRLR LTGIGPPQSG GSDVLQEIGM KLAQLAETVK VEFEFRGVVA  360
VKLDDIKPWM LQICHGEAVA VNSVFQLHKL LYSAGSVIPI DEVLRSARAL KPKIFTIVEH  420
EANHNQPSFL GRFTEALHYY STMFDSLEAC SLPSDSSEQV LAEMYLGREI NNIVACEDAA  480
RVERHENLVQ WQMRMLKAGY RPIQLGLNAF KQASMLLTMF SGDGYRVEEK LGCLTLGWHT  540
RPLISASAWQ CA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-541835504375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.164920.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2627510.0EU262751.1 Physcomitrella patens DELLA-like protein mRNA, complete cds.
GenBankEF6464730.0EF646473.1 Physcomitrella patens DELLA protein (DELLAb) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001754090.10.0GAI1-like E3 ubiquitin ligase protein
SwissprotQ8S4W71e-155GAI1_VITVI; DELLA protein GAI1
TrEMBLA7U4T70.0A7U4T7_PHYPA; DELLA protein
STRINGPP1S12_244V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-150GRAS family protein
Publications ? help Back to Top
  1. Yasumura Y,Crumpton-Taylor M,Fuentes S,Harberd NP
    Step-by-step acquisition of the gibberellin-DELLA growth-regulatory mechanism during land-plant evolution.
    Curr. Biol., 2007. 17(14): p. 1225-30
    [PMID:17627823]
  2. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]