PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_5870V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 394aa    MW: 42606.2 Da    PI: 8.786
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_5870V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-3960120262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++ ++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg+rknk+++
  Pp3c22_5870V3.1.p  60 PDQVIACPRCQSLNTKFCYYNNYSLTQPRHFCKSCRRYWTAGGTLRNVPVGGGCRKNKRTK 120
                        68899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2658118IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3361118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.21764118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MVNVEKPHMS VAVLGHGDWA MIPSSSSHEP QQQTQQHQQE KKASQLFAQR ALQERRLKPP  60
DQVIACPRCQ SLNTKFCYYN NYSLTQPRHF CKSCRRYWTA GGTLRNVPVG GGCRKNKRTK  120
PRTPEGSNSG TGSADVDSMS SSGLQHPGFT PTSIGFLSSS EGSPYGLADP SIRADSSMSQ  180
SSKIGLPMPY QPGGQSSALA QHQQLHPFEG GIPGLGFFRN PGRVAETALN LHPTFQMPTG  240
DLSEMFDTSS VSRTGALAAL SEGLGTFNVN AEGGRDQQGF VSLERWQQAA KQHSSSGMWG  300
SHEIAQAQSN IGMGRQQDVK GKMTLGLVPI TGMDTSKGQQ QQRPTPSWQH SNPPENSGLH  360
FEQQPEQNYW NNSGGWPSMD SQAYQSSGGG QAL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.86780.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361202.10.0dof zinc finger protein 3-like
RefseqXP_024361204.10.0dof zinc finger protein 3-like
RefseqXP_024361205.10.0dof zinc finger protein 3-like
RefseqXP_024361206.10.0dof zinc finger protein 3-like
RefseqXP_024361207.10.0dof zinc finger protein 3-like
TrEMBLA0A2K1IMF00.0A0A2K1IMF0_PHYPA; Uncharacterized protein
STRINGPP1S12_364V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-34TARGET OF MONOPTEROS 6