PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_16800V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 272aa    MW: 28906.6 Da    PI: 6.1732
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_16800V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.31.8e-4581071100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasn++kll++lp+++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++ql+
  Pp3c22_16800V3.4.p   8 PCAACKFLRRKCTAECVFAPYFPPDQPHKFANVHKIFGASNITKLLNELPTHQREDAVNSLAYEADARVKDPVYGCVGAISVLQRQVAQLQ 98 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la +++ 
  Pp3c22_16800V3.4.p  99 NDLAIAHSD 107
                         ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0127108IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MASSSSSPCA ACKFLRRKCT AECVFAPYFP PDQPHKFANV HKIFGASNIT KLLNELPTHQ  60
REDAVNSLAY EADARVKDPV YGCVGAISVL QRQVAQLQND LAIAHSDLAR YAGAGMVVPS  120
VGQGGASSSL GIGISLSQGQ ANREHMLTRE QLMDLARGDP SHLSREHLME LARAGGDLEA  180
KAETGAEAEV EVGAEAELVP AILADKSLHH DGLEPGVVLR ERESYEFGRS VSQISPTTLM  240
LGTLDDSKGS NVKVNFSLRV LGVSSHDSVK C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-6051128115LOB family transfactor Ramosa2.1
5ly0_B6e-6051128115LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361359.11e-127protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A2K1INT71e-126A0A2K1INT7_PHYPA; Uncharacterized protein
STRINGPP1S71_7V6.11e-127(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-59LOB domain-containing protein 25