PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_16800V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 240aa    MW: 24635.6 Da    PI: 8.7436
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_16800V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.71.3e-45121111100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasn++kll++lp+++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++ql+
  Pp3c22_16800V3.2.p  12 PCAACKFLRRKCTAECVFAPYFPPDQPHKFANVHKIFGASNITKLLNELPTHQREDAVNSLAYEADARVKDPVYGCVGAISVLQRQVAQLQ 102
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la +++ 
  Pp3c22_16800V3.2.p 103 NDLAIAHSD 111
                         ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.01211112IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4412109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MKRGMASSSS SPCAACKFLR RKCTAECVFA PYFPPDQPHK FANVHKIFGA SNITKLLNEL  60
PTHQREDAVN SLAYEADARV KDPVYGCVGA ISVLQRQVAQ LQNDLAIAHS DLARYAGAGM  120
VVPSVGQGGA SSSLGIGISL SQGQANREHM LTREQLMDLA RGDPSHLSRE HLMELARAGG  180
GTYETLQALG LSGALGPLRS FPSNSRSGGE SGNRSGGGSG GGGGGGASAS NTGGQIPSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-601111610115LOB family transfactor Ramosa2.1
5ly0_B1e-601111610115LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361359.11e-174protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A2K1INT71e-169A0A2K1INT7_PHYPA; Uncharacterized protein
STRINGPP1S71_7V6.11e-170(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-59LOB domain-containing protein 25