PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_13060V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 681aa    MW: 75152.8 Da    PI: 6.5986
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_13060V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS400.71.5e-1223206782374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lLl+cAea+s++d+++a+a+L +lsela+p g+++qR++ayf+e + +rl+ s+ ++++ lp+++ +++  ++ ++a+++f+e++P++k
  Pp3c22_13060V3.1.p 320 MSLLLQCAEAISADDNNQATAILPQLSELATPFGTSVQRVVAYFAESMGSRLVTSSLGICRPLPCKQPASN--QSIVSAMQVFNEICPFVK 408
                         689*****************************************************************965..55567999********** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                         fsh+taNqaI ea+eg+  vHiiD di+qGlQWp+L+q LasR++gpp++ iTg+g     s+e+l +tg+rL++fA ++g++fef++ +a
  Pp3c22_13060V3.1.p 409 FSHFTANQAIAEAFEGKFNVHIIDVDIMQGLQWPSLFQVLASRAGGPPHVHITGLGT----SAESLDATGKRLKDFAGSFGISFEFTA-IA 494
                         *********************************************************....9**************************.7* PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                         ++++++++++L+v   +alaV++++  h+l+d ++s  +    +L+l+++l+Pkv+++veq+  h s++Fl rfleal+yysa+fdsl a+
  Pp3c22_13060V3.1.p 495 DKMSNVDISTLKVAFSDALAVHWMH--HSLYDVTGSDLD----TLSLIQKLNPKVITLVEQDFRH-SGTFLSRFLEALHYYSAMFDSLGAT 578
                         *************************..999999999988....**********************.89*********************** PP

                GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkd 364
                            +s er +vE++ll+ ei+n+va  g  r+ +h+ + +Wr+ l++aGFkpv+ls ka  qa lll+     dgy++ e+sgsl lgWkd
  Pp3c22_13060V3.1.p 579 CKDDSPERYMVEQQLLSCEIKNIVAFDGPGRKINHK-FDQWRDELSKAGFKPVSLSGKASHQAALLLQSLFpCDGYTLLEHSGSLKLGWKD 668
                         ******************************888887.******************************99877******************* PP

                GRAS 365 rpLvsvSaWr 374
                           L+++SaW+
  Pp3c22_13060V3.1.p 669 LYLFTASAWT 678
                         *********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.773293657IPR005202Transcription factor GRAS
PfamPF035145.2E-120320678IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MRCDAKEPYQ SPVPIMNAAP RDDWGKIADA LSHHQQLPSH NDKAQQGSNG CGAQTREEAR  60
DQSAEMDEDS IAAWVDGTIT EMMEAMPGVA IEQLFTNLPE FLSPCNLHLK GLIGCRLQLL  120
LGGAGYPSKN FPPPGPNRSG KRTREVQVEW TNSKTFQNES QDLHETLPRH HVRPENFISQ  180
KKVAASLSRV DLRCPKPLKR SIDNLQLSLE PADERNLRHL HIGLQATQKD QSSHQVRHSR  240
AQSTEPVQQH YHKLHTHNVQ DKADGFLQRS PAPSSASQFS TLNTMGSEDP PSQPQKLPQT  300
TAQNAQREDT VAPDEGLQLM SLLLQCAEAI SADDNNQATA ILPQLSELAT PFGTSVQRVV  360
AYFAESMGSR LVTSSLGICR PLPCKQPASN QSIVSAMQVF NEICPFVKFS HFTANQAIAE  420
AFEGKFNVHI IDVDIMQGLQ WPSLFQVLAS RAGGPPHVHI TGLGTSAESL DATGKRLKDF  480
AGSFGISFEF TAIADKMSNV DISTLKVAFS DALAVHWMHH SLYDVTGSDL DTLSLIQKLN  540
PKVITLVEQD FRHSGTFLSR FLEALHYYSA MFDSLGATCK DDSPERYMVE QQLLSCEIKN  600
IVAFDGPGRK INHKFDQWRD ELSKAGFKPV SLSGKASHQA ALLLQSLFPC DGYTLLEHSG  660
SLKLGWKDLY LFTASAWTRV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-1532986782379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the initial daughter cell before its asymmetric division and remains expressed in the endodermal cell layer after the division. {ECO:0000269|PubMed:17446396}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for cell division but not differentiation of the ground tissue. Regulates the radial organization of the shoot axial organs. Restricts SHR movment and sequesters it into the nucleus of the endodermis (By similarity). {ECO:0000250, ECO:0000269|PubMed:17446396}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024360437.10.0protein SCARECROW 1-like
SwissprotQ2RB591e-152SCR1_ORYSJ; Protein SCARECROW 1
TrEMBLA0A2K1INB70.0A0A2K1INB7_PHYPA; Uncharacterized protein
STRINGPP1S324_56V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21831437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-146GRAS family protein