PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_11080V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GATA
Protein Properties Length: 423aa    MW: 45267.5 Da    PI: 6.114
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_11080V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20261295135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++Cgt+kTplWR+gp+g+k+LCnaCG++++k g+
  Pp3c22_11080V3.1.p 261 CAHCGTSKTPLWRNGPQGPKSLCNACGIRFKKAGR 295
                         ********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.2E-19255317IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.99E-14256297No hitNo description
PROSITE profilePS5011412.888259294IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-17259295IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.52E-15260301No hitNo description
PfamPF003202.4E-18261295IPR000679Zinc finger, GATA-type
PROSITE patternPS003440261286IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009909Biological Processregulation of flower development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MLQESLGNFE LHGSLQPIWV RECSAHADVR EDALLDLNSI PNLLKPPSLT AAVGLTKAAA  60
SFTGGGSCDS ESSSVGMDES ICGDPSLAVD CTLSLGSSAT QRMDIPARLS RAGSPAQDLV  120
WSLSARSEPA DALTRHTCEQ DVSEQGVSWD VSSSRSDPDA TPEYQPQMAV SDRTASGEDT  180
VHRSGSKTWA KPCVPTNDRD EVNTSKGHLS MIDGSAYDSR PGRQSWLPNF LSSTGLASEV  240
KATSRFERCM QPEGINFVRV CAHCGTSKTP LWRNGPQGPK SLCNACGIRF KKAGRRSAAN  300
GSSELQDTPL TSVTAVKVEN PKAVDADVDH QQCWECSPEV KPRKRSRGSF LHQRASESSL  360
SGGSCMTWQS CLLTSSPKNV DSRASPIVGS REKKLVFRKA FSTDEEEGAE LLMALSCGMV  420
YT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00110ampDAPTransfer from AT2G18380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S121_33V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18380.14e-16GATA transcription factor 20