PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c21_18550V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Trihelix
Protein Properties Length: 743aa    MW: 82221.9 Da    PI: 8.3611
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c21_18550V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.81.1e-31229313187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laLi++r++m+ ++r++ lk+plWe+vskk++e g++rs+k+Ckek+en++k+ykk+k+g+ +r++++s  +++f+qlea
  Pp3c21_18550V3.1.p 229 RWPRQETLALIKIRSDMDANFRDSGLKGPLWEDVSKKLAELGYSRSAKKCKEKFENVHKYYKKTKDGRAGRQDGKS--YRFFSQLEA 313
                         8*********************************************************************866665..*******85 PP

2trihelix106.22.2e-33555639186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k evl+Li++r++me+r++++  k+plWee+s+ m+  g++r++k+Ckekwen+nk+++k+ke++kkr +e+ +tcpyf+qle
  Pp3c21_18550V3.1.p 555 RWPKPEVLTLIKLRSDMETRFQEAGPKGPLWEEISQGMACLGYNRNQKRCKEKWENINKYFRKTKESNKKR-PENAKTCPYFHQLE 639
                         8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.9E-4226288IPR001005SANT/Myb domain
CDDcd122031.29E-30228293No hitNo description
PfamPF138377.1E-22228314No hitNo description
PROSITE profilePS500906.748228286IPR017877Myb-like domain
SMARTSM007170.0034552614IPR001005SANT/Myb domain
CDDcd122033.51E-32554619No hitNo description
PfamPF138377.3E-22554639No hitNo description
PROSITE profilePS500907.062555612IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MQNTGQYGVS DSPQFVVGRP PPHIFAISHD NMSISTSSAG HPLPGHHQQQ HHLPHHLQAQ  60
HHHYGPHPGH QPHPSLQAHQ QIHQTQSSHA THAPHPQHPQ FPLAQHPQAQ QQQQQQQQQQ  120
QPAQAHVSST HQDVAQHQQH QQAQQQKQQQ AQQQAQQIAQ QAQQAQQQAQ QAQQQMVQQL  180
GLGGPDSPEV PSPGVSRPSP TNYSQQQIVN PAQDDDGLEE EGRSTGGNRW PRQETLALIK  240
IRSDMDANFR DSGLKGPLWE DVSKKLAELG YSRSAKKCKE KFENVHKYYK KTKDGRAGRQ  300
DGKSYRFFSQ LEALYGGQQT SAQLESNAAV VAAANLLTGS AIPGKVVNED YNVSTQRPSE  360
VSTGVTLSES SEDDYDEPGG GEADNQEKSS KKRKRMEGGK SGTSKLDFFE SLMKNLMDKQ  420
ESMQRKFLEF MERREQDRQV WEEAWRRQEM TRLAREHELR AQEQALAATR DAALVAFLQK  480
VTGQTLQLPQ FPTRPPVVAV PPSIDSVVAA QKHQPTPPPT TSAPAVPPTT TSQQLVVSNV  540
DDHDKDSPID PNSKRWPKPE VLTLIKLRSD METRFQEAGP KGPLWEEISQ GMACLGYNRN  600
QKRCKEKWEN INKYFRKTKE SNKKRPENAK TCPYFHQLEV LYRQGVLGTP SNKQAAKAAD  660
SPARDFVDHQ AVPLAHRTEA AAGAKAGDSE MLKMLPAAAE AVQNAASSGN GTPSAAAHFF  720
SSPENGSSAE RGGPKQGSEP SL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.66320.0protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024359363.10.0trihelix transcription factor GTL1-like
TrEMBLA0A2K1ISI30.0A0A2K1ISI3_PHYPA; Uncharacterized protein
STRINGPP1S85_58V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-56Trihelix family protein