PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c21_17650V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 892aa    MW: 97679.5 Da    PI: 6.6323
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c21_17650V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS373.62.5e-1145308892374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                           lLl+cAeavssg++ +a+++L +l+e+++p+g+++qR++ayf+e++a+rl+ s+ ++ + lp ++    n  + ++a ++f+e++P++k
  Pp3c21_17650V3.2.p 530 LALLLQCAEAVSSGNHDEANTILPQLREQVTPYGSSVQRVVAYFAEGMASRLVTSCLGINSPLPRNDLV--NNPSFTSAIQVFNEICPFVK 618
                         579*********************************************************999888886..577788999*********** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                         fsh+ta qaI ea+eg + vH+iD+di++GlQW  Llq La+Rp+gpp++ iTg+g     s e+l +tg+rL +fA++lgv+f+f++ va
  Pp3c21_17650V3.2.p 619 FSHFTAIQAISEAFEGMNNVHVIDMDIMHGLQWHLLLQNLAKRPGGPPHVHITGLGT----SVETLDATGKRLIDFAATLGVSFQFTA-VA 704
                         *********************************************************....9**************************.7* PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                         +++ +l++++L+v+  +alaV++++  h+l+d s++ +     +L l+ +lsPk++++veq++ h +++Fl+rf+eal+yysalfdsl a+
  Pp3c21_17650V3.2.p 705 EKFGKLDPSALKVEFSDALAVHWMH--HSLYDVSGCDSA----TLGLMHKLSPKIITIVEQDLRH-GGPFLNRFVEALHYYSALFDSLGAS 788
                         ************************9..999988888777....**********************.789********************** PP

                GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk.vk.sdgyrveeesgslvlgWk 363
                         + r+s +r++vE++ll+ ei+n++a  g  r    +++ +Wr++l+eaGF+pv+ls +a+ qa lll++ ++ ++gy++ e+ g+l lgW+
  Pp3c21_17650V3.2.p 789 YNRKSLKRHMVEQQLLSCEIKNILAIGGPGRSGT-TKFDHWRDKLSEAGFNPVALSAQAVHQAALLLSQgFYpGEGYTLLEDLGALKLGWE 878
                         ******************************6665.56***************************999653778****************** PP

                GRAS 364 drpLvsvSaWr 374
                         d  L+++SaW+
  Pp3c21_17650V3.2.p 879 DLCLFTASAWT 889
                         **********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.625503867IPR005202Transcription factor GRAS
PfamPF035148.6E-112530889IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 892 aa     Download sequence    Send to blast
MAIVCPNPSK RLRSVSTELL PGVITGTCTQ YADLPGYRSL VTAEDRDQLR MTDHYTLRNS  60
GQISSDAGGS CGVHWDVHRR ADSLDHGSDH LVDLDFTVGS NWPNSTLPPV APVSSWSNYT  120
FASNSFPTSS SGWEVPPLED NITVTFPSNV TFPNHLSSGI SAPNNFTNTL PQSLQLETCG  180
SASIRDGFFS SGLAQARSGN VQHLYQTQPL LINAEPGNSL GKIADAVPSH QHQHVPQFDM  240
PQHRTHSFSA HNASENVKDQ FAGLDEDAVS QWVDGMIRGM MEVMPGMPIE HLFANLSEAL  300
APGYVNAERV IRSRLHPLYA SARGRVQNTL PIDLARAGKR PRVEYNDGAK GQVYRENANS  360
SQNTSQTFKN AISGLHDRQE NVMQIQAAVS HPSPELREDQ QLPFSSSQKR TDDNLQLSLE  420
PADERSLRHL HTTRQPSLSK FGHQGVTSRD SPGPSHLKQY PQIQPHYHQK PKLGNTILDF  480
DVRSSVSQCS AQNARDCQGL PSLPLDVPQT SSQKRQSHEP STSQEGLQLL ALLLQCAEAV  540
SSGNHDEANT ILPQLREQVT PYGSSVQRVV AYFAEGMASR LVTSCLGINS PLPRNDLVNN  600
PSFTSAIQVF NEICPFVKFS HFTAIQAISE AFEGMNNVHV IDMDIMHGLQ WHLLLQNLAK  660
RPGGPPHVHI TGLGTSVETL DATGKRLIDF AATLGVSFQF TAVAEKFGKL DPSALKVEFS  720
DALAVHWMHH SLYDVSGCDS ATLGLMHKLS PKIITIVEQD LRHGGPFLNR FVEALHYYSA  780
LFDSLGASYN RKSLKRHMVE QQLLSCEIKN ILAIGGPGRS GTTKFDHWRD KLSEAGFNPV  840
ALSAQAVHQA ALLLSQGFYP GEGYTLLEDL GALKLGWEDL CLFTASAWTS T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-1495088892379Protein SCARECROW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024358664.10.0protein SCARECROW-like isoform X1
TrEMBLA0A2K1ISE40.0A0A2K1ISE4_PHYPA; Uncharacterized protein
STRINGPP1S85_139V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-147GRAS family protein