PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c21_17550V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Trihelix
Protein Properties Length: 500aa    MW: 56010.8 Da    PI: 7.0679
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c21_17550V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.78.8e-30221305187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++ e+laLi++r++++ ++r++  k+plWe+vs+k++e g++rs k+Ckek+en++k+ykk k+g+ +r++++s  +++f ql+a
  Pp3c21_17550V3.1.p 221 RWPRAETLALIQIRSDLDANFRDSGVKGPLWEDVSRKLAEMGYNRSGKKCKEKFENIHKYYKKSKDGRAGRQDGKS--YRFFAQLDA 305
                         8*********************************************************************866665..******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.841214278IPR017877Myb-like domain
SMARTSM007170.0045218280IPR001005SANT/Myb domain
PfamPF138374.8E-22220306No hitNo description
CDDcd122037.69E-31220285No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MQSTGQYGVS DSPQFLVARA PHIFSISHDS ISLSPPAGHA HQGHHPHQHH LPHHLQAPHH  60
LYGGHLSHQP HPSLQQIHQP QSSHASHAQH LQHAQHPQHS QHAPHSQHPA HPLPQLQQAQ  120
QQPASHASSS HQDVPQQQLQ QVQQQEEQHK QLVREQQQAQ EQQHAQEQMV QQLGLGDPDS  180
PDAPSPIASR PSPTNYSKLL LSAQQDDEGL EEERGNSGGN RWPRAETLAL IQIRSDLDAN  240
FRDSGVKGPL WEDVSRKLAE MGYNRSGKKC KEKFENIHKY YKKSKDGRAG RQDGKSYRFF  300
AQLDALFGGQ QTSTQVETDT AAAVLLIGNA PPLGISPTDQ DLNVSVQRAS EVSTGVTVSK  360
SSDDDYDGPG SGLRDNQDKK KNRKRKQIES VKFGTPKLDF FETLMKNMID KQEAMQMRFL  420
EMIEKMEQDR QAKEDAWRRQ EVARWQREHD LRAQENAIAA ARDSALISFL QKVTGQNIQL  480
SNFSTPLPTG IPPTRESEE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1379386KKNRKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.101770.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024359406.10.0trihelix transcription factor GTL1-like
TrEMBLA0A2K1ISD90.0A0A2K1ISD9_PHYPA; Uncharacterized protein
STRINGPP1S85_150V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03680.11e-46Trihelix family protein