PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_9330V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 322aa    MW: 35457.8 Da    PI: 8.3738
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_9330V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.7e-43131131101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rr+C++dC+l+pyfp +qpk+f+nvhklFG+sn+l++lk++++++red+++s++yeA+ r +dPv+G++gvi+ lq+q+++lk 
  Pp3c20_9330V3.1.p  13 ACAACKYQRRRCTPDCPLSPYFPPDQPKRFQNVHKLFGVSNILRILKHVDPSKREDTVKSIAYEADTREKDPVHGCLGVITILQNQVSKLKD 104
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        ela+++e+l
  Pp3c20_9330V3.1.p 105 ELAVAREQL 113
                        ****99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.47412113IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4113110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MTGSSSSGGT NTACAACKYQ RRRCTPDCPL SPYFPPDQPK RFQNVHKLFG VSNILRILKH  60
VDPSKREDTV KSIAYEADTR EKDPVHGCLG VITILQNQVS KLKDELAVAR EQLYLLQQHH  120
NFNQQAQIQQ IVGSLGGNTT VVNVSSGHDN NVLMHQLQQF NELNQLSSDF VKSNPLPGSS  180
FEPDQYLRND GFEQLKPGSA LTTRFDVGRY IPGESLVQQS VLLGQVKLKE QSEQQRGHYG  240
IAGAGSSFIP TPCGDHNLLQ DVDRAFGTPD QYAMAIRRRG SNLLNLTVAS EAELRRATGG  300
HHGVPKHELR SAVVYLTLTN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-3931471131LOB family transfactor Ramosa2.1
5ly0_B7e-3931471131LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024357789.10.0LOB domain-containing protein 22-like isoform X1
RefseqXP_024357790.10.0LOB domain-containing protein 22-like isoform X1
TrEMBLA0A2K1IUQ90.0A0A2K1IUQ9_PHYPA; Uncharacterized protein
STRINGPP1S9_450V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-41LOB domain-containing protein 25