PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_7710V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 276aa    MW: 30755.5 Da    PI: 7.3685
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_7710V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.4e-43161161101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC++dC+l+pyfp +qpk+fanvh+lFG+s +l+llk++++++r+d+++s++yeA+ r +dPv+G++gvi+ lq+q+++lk+
  Pp3c20_7710V3.1.p  16 ACAACKYQRRKCTPDCPLSPYFPPDQPKRFANVHRLFGVSSILRLLKHVDPSKRDDTVKSITYEADTREKDPVHGCLGVITMLQNQVSKLKE 107
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        el+ ++++l
  Pp3c20_7710V3.1.p 108 ELNIARQQL 116
                        *****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.22815116IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4116113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGVQQKASSS NTTNTACAAC KYQRRKCTPD CPLSPYFPPD QPKRFANVHR LFGVSSILRL  60
LKHVDPSKRD DTVKSITYEA DTREKDPVHG CLGVITMLQN QVSKLKEELN IARQQLLMME  120
QQQAMAVAGQ QLQSFQSPHG LLVESGYEDY DSQLLRYHIG GHEVDKFDQK LNILPLDYRY  180
GGEDTHLMNL TKADQAEQHR RTGACFGIDP ESHRQTHSQA THDQSSRSST SISPAGYGII  240
PDADIKGANY LLSSGQCHVL DHELRRAGVY LSLTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3871172112LOB family transfactor Ramosa2.1
5ly0_B2e-3871172112LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024357736.10.0LOB domain-containing protein 6-like
RefseqXP_024357737.10.0LOB domain-containing protein 6-like
TrEMBLA0A2K1IUI60.0A0A2K1IUI6_PHYPA; Uncharacterized protein
STRINGPP1S9_303V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-41LBD family protein