PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_6540V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 213aa    MW: 23308.2 Da    PI: 9.4926
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_6540V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.58.3e-42351341100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da+sslvyeA+ar+rdPvyG++g i++lqqq + l+a
  Pp3c20_6540V3.1.p  35 PCAACKLLRRRCAQECPFSPYFSPQEPQKFACVHKIFGASNVSKMLMEVPENQRADAASSLVYEANARIRDPVYGCMGAISALQQQAQALQA 126
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el++++ e
  Pp3c20_6540V3.1.p 127 ELNAVRME 134
                        ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.33134135IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4135132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MLVHSRAQHG ERKVKSPTTE SRKKMLNSQG QGSTPCAACK LLRRRCAQEC PFSPYFSPQE  60
PQKFACVHKI FGASNVSKML MEVPENQRAD AASSLVYEAN ARIRDPVYGC MGAISALQQQ  120
AQALQAELNA VRMEINRYRQ HENSPTNGTL TTTASATALV SGYQELVQDR GRASDTRSSK  180
PSTTDVHTTV HSPSSTVATS ESKDRTYWSP IT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-46301387114LOB family transfactor Ramosa2.1
5ly0_B1e-46301387114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots and at low levels in flowers, but not in leaves or inflorescence stems. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024358125.11e-159LOB domain-containing protein 15-like isoform X1
SwissprotQ9AT615e-58LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A2K1IJC41e-103A0A2K1IJC4_PHYPA; Uncharacterized protein
STRINGPP1S9_186V6.11e-158(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-55LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]