PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_22630V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GATA
Protein Properties Length: 478aa    MW: 51977.9 Da    PI: 6.4406
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_22630V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.47e-17292326135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C+t  Tp+WR gp g+ktLCnaCG++y++ +l
  Pp3c20_22630V3.1.p 292 CMHCQTQRTPQWRTGPMGPKTLCNACGVRYKSGRL 326
                         99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.424286322IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.4E-14286323IPR013088Zinc finger, NHR/GATA-type
SMARTSM004019.6E-14286336IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.14E-14287349No hitNo description
CDDcd002021.10E-12291338No hitNo description
PfamPF003201.3E-14292326IPR000679Zinc finger, GATA-type
PROSITE patternPS003440292317IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MVSPYMVAGP FGSYGLPEID KPSIPEVFHI DDLLDFSCDD IGGPILGGHL PLSGVTTESS  60
MIGGETSISS SPIEAKNETL EPALEDIEVK TDLCVPCDDL ADLEWLSSFV EDSFTVVNTP  120
EVFSTYGGFP SALGNGDRTP TMKLSDSYQP YQKLSPTSVL ETSATSSELT SPDYRDVCVP  180
GRARSKRSRT GAKIWTSRIL STSSSVNSLE SMGADSYAMS YNPIVSSSDG CGDSTVDVVE  240
QDDEDSQGSK RYKVTNDGHS QSESKDNISA NFHSNASKGR KKNQDNSQPW RCMHCQTQRT  300
PQWRTGPMGP KTLCNACGVR YKSGRLLPEY RPAGSPTYVA SKHSHSHKKV LEMRRERELR  360
IQQTGGHGVQ QQQSMHGATP LREKTNNQKV AGAKSSSGEH VKSEYGGGYG SKNLETMQKS  420
FSKPMEMPRP GKPEMMKYAS KASGMEFAKC LTSTTAVLGS RLEFGLDDNS MREMRGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001778541.13e-97predicted protein, partial
TrEMBLA9TIX13e-97A9TIX1_PHYPA; Predicted protein (Fragment)
STRINGPP1S241_7V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-37GATA transcription factor 9