PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_17760V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LFY
Protein Properties Length: 253aa    MW: 28147.2 Da    PI: 9.0566
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_17760V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY36.57.5e-1214221538114
             FLO_LFY  38 eaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavr 114
                          +++++ + +l +l+ ++ ++G+r  t+ ki+e+Gft +t++   d el  l++s+ +  ++ l +Ge +Gik a +
  Pp3c20_17760V3.2.p 142 IKSTVSDTGDLADLDFFLDGFGIRAETIGKIKEMGFTGKTFMSNVD-ELLTLLDSIKQ--HCHLTLGEEWGIKGAAK 215
                         122222233355889999***********************98665.56678888887..577899*******9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016986.8E-7143215IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MVRVKGGEWG HVLVVKEPAK HGMAWHVKCT HCGKVFQGNA MRIRSHLLGH PEKVSGCPAC  60
PAEAREELRL SYLAKSQVER KNRQNRSFKA SRTSHQRRKD AQQGDPMLDP KHTEEKLAVE  120
QALRNMAFQA GLPVNYVNHS AIKSTVSDTG DLADLDFFLD GFGIRAETIG KIKEMGFTGK  180
TFMSNVDELL TLLDSIKQHC HLTLGEEWGI KGAAKKWQKG HGIINSQTEL EKWPDPEFKS  240
APGCKEEVLS LP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.141200.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024357504.10.0uncharacterized protein LOC112273240
TrEMBLA0A2K1IVN00.0A0A2K1IVN0_PHYPA; Uncharacterized protein
STRINGPP1S44_262V6.10.0(Physcomitrella patens)