PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c20_11430V3.1.p
Common NamePHYPADRAFT_88203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family G2-like
Protein Properties Length: 516aa    MW: 56622.1 Da    PI: 8.1685
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c20_11430V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-32295350156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pp3c20_11430V3.1.p 295 KARRCWSPELHRRFVSALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 350
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.889292352IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-29293353IPR009057Homeodomain-like
SuperFamilySSF466891.77E-17293353IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26295350IPR006447Myb domain, plants
PfamPF002493.0E-7297348IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MGSPANLALG PQVSTITSTI ETALNCTVSA DGLEADEIQK IAAHLRALQE ERGKIEAFKR  60
ELPLCMQLLD EAIETAINKV MVDQCSPTAS LQTSVLDAQD SDYERPKRTL VLENFMPLKR  120
RWEKQLKEKI FQNDAGNNSQ QHEDKVVIGR PAWMKETQLW TKQSESIDYE KASPSRGSRR  180
QVEFKCSEQD RPLTSSRLLL NSKDRQGGAF VPFNREKQLP SPPFSSQSTG PASDAAGFST  240
SSAVRTPSRM GHTIESFDIG RVNGNVHVRD HSSDARNSID HSVQTRTGAN QPQRKARRCW  300
SPELHRRFVS ALQQLGGSQV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSPSPPS  360
PSHAPQLVVV GWVRPEFTAV EGAASQASTG DNPLPGISNE CVPSQSTGQP QKQSPPNFQK  420
HLPAVSTSQT SLRGPSPVGV DSPHSSSDSY IDESDDEQDG NCTSSGENGR QYECNEKPLQ  480
SARESKGSTT CLADIDATIN PQMKLRILRK TKAAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-14295348154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-14295348154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-14295348154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-14295348154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-14295348255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024357508.10.0transcription factor NIGT1-like isoform X1
TrEMBLA9T5480.0A9T548_PHYPA; Predicted protein
STRINGPP1S166_107V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-54G2-like family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]