PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_37070V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 361aa    MW: 40132.7 Da    PI: 4.6089
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_37070V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-1892145356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t +q++ Le+ Fe+++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c1_37070V3.1.p  92 KKRRLTFDQVRSLERNFEMENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 145
                        45578999*********************************************9 PP

2HD-ZIP_I/II117.29e-3891183193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ +qv++LE++Fe+e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L + y +lk e e+  +e++ L++e++
  Pp3c1_37070V3.1.p  91 EKKRRLTFDQVRSLERNFEMENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYEVLNSGYLKLKVEFETALREKDFLKAEVQ 182
                        69**************************************************************************************9998 PP

        HD-ZIP_I/II  93 e 93 
                        +
  Pp3c1_37070V3.1.p 183 R 183
                        6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1983149IPR009057Homeodomain-like
PROSITE profilePS5007117.68687147IPR001356Homeobox domain
SMARTSM003891.4E-1490151IPR001356Homeobox domain
PfamPF000467.8E-1692145IPR001356Homeobox domain
CDDcd000861.56E-1692148No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1994154IPR009057Homeodomain-like
PRINTSPR000316.7E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000316.7E-6127143IPR000047Helix-turn-helix motif
PfamPF021835.4E-13147188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MSVAMAATSL GSFGGQNVIL VRNDMRGSDS MLAMLTSCNP VLGFQVPRSG GGLEDAIAGC  60
GQKRLFYPTF ENSPVEETED GDDGGDEGRV EKKRRLTFDQ VRSLERNFEM ENKLEPERKM  120
QLAKELGLQP RQVAVWFQNR RARWKTKQLE RDYEVLNSGY LKLKVEFETA LREKDFLKAE  180
VQRLSGKTSS QDSQGCQSPA DPSQCESETT CSDKTKPDIA VSLKDHYARS SQTVDVVSSA  240
HKLTNGDSKE MSTSSGSNSS DLLDTDSTRV SDSCYLSRIQ DEQLAGYSSN QLPPESFVGP  300
NLLHGDDAEP FCGRDVAQQV NFPVKLEDAS HFQMPDIPNC IYFLPQIVSE QSVLPWWDWP  360
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.160210.0gametophore
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024370524.10.0homeobox-leucine zipper protein HAT5-like
TrEMBLA0A2K1LB900.0A0A2K1LB90_PHYPA; Uncharacterized protein
STRINGPP1S28_46V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-38homeobox protein 16