PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_36940V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 366aa    MW: 40740.5 Da    PI: 7.0782
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_36940V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.5e-18106159356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c1_36940V3.1.p 106 KKRRLSFDQVQSLERSFELENKLEPERKLQLAKELGLQPRQVAVWFQNRRARWK 159
                        45578889*********************************************9 PP

2HD-ZIP_I/II117.57.5e-38105195191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        ekkrrls +qv++LE+sFe e+kLeperK +la+eLglqprqvavWFqnrRAR+k kqlE+dy aL + y++lkee e+++++ +  ++e+
  Pp3c1_36940V3.1.p 105 EKKRRLSFDQVQSLERSFELENKLEPERKLQLAKELGLQPRQVAVWFQNRRARWKIKQLERDYGALAKDYNRLKEEFEAVSRDRNGYKAEV 195
                        69*******************************************************************************9998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.05E-1897162IPR009057Homeodomain-like
PROSITE profilePS5007117.443101161IPR001356Homeobox domain
SMARTSM003894.3E-16104165IPR001356Homeobox domain
PfamPF000461.3E-15106159IPR001356Homeobox domain
CDDcd000864.38E-16106162No hitNo description
Gene3DG3DSA:1.10.10.601.1E-18108168IPR009057Homeodomain-like
PRINTSPR000319.6E-6132141IPR000047Helix-turn-helix motif
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PRINTSPR000319.6E-6141157IPR000047Helix-turn-helix motif
PfamPF021831.3E-10161200IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MPGGSGSLMQ NERNMAVASL SSYSGQNFKL MRNIGSNTNS LVAMLQGSCS PRIASNQVPR  60
SMGSPKDMTK VCGQKRPFYP TIDRRSVEEP DDDDEGADEF SLRSEKKRRL SFDQVQSLER  120
SFELENKLEP ERKLQLAKEL GLQPRQVAVW FQNRRARWKI KQLERDYGAL AKDYNRLKEE  180
FEAVSRDRNG YKAEVNLLKG IRNDDPDSPI TTPIRCLSET MHHPASPAQS EKSDIISCRN  240
CASPSIDVNP VPSKEAGVTG TMSPDCNSSN TIDADSPLTS HSTTSWRSLY TRMAQTDKAP  300
WGAQHTQFPP ESFAGPNFPH PCADQSLAAA VAGARVKIHN LGADQAFVAS RMEEQTILTN  360
WWDWD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153161RRARWKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1410.0gametophore| protonema
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280800.0AB028080.2 Physcomitrella patens mRNA for homeobox protein PpHB9, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024392695.10.0homeobox-leucine zipper protein HOX20-like isoform X1
TrEMBLA0A2K1LB910.0A0A2K1LB91_PHYPA; Uncharacterized protein
STRINGPP1S28_54V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.18e-40homeobox protein 16