PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_2540V3.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 658aa    MW: 72210.9 Da    PI: 5.5072
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_2540V3.7.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.94.5e-1422886572374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAea+s++d+ la+ l+a+l++ +s +gdpmqRlaay++e+L ar+a s++++y++l++++ +   + + l+a+++++ev+P++kf+
  Pp3c1_2540V3.7.p 288 EQLLVACAEALSNNDMPLANVLIAQLNQVVSIYGDPMQRLAAYMVEGLVARVAASGKGIYRSLKCKDPP---TRDLLSAMQILYEVCPYFKFG 377
                       689*****************************************************************9...899****************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +++aN  I ea+++e+rvHiiDf+i qG+QW +L+qaLa+Rp+gpp+lRiTg+++p +g  s+  +e +g+rLak+Ae++gvpf+f++ vak+
  Pp3c1_2540V3.7.p 378 YMAANGSIAEAFQNESRVHIIDFQIAQGTQWTTLIQALAARPGGPPHLRITGIDDPMPGpnSNAGVEMVGKRLAKLAEAVGVPFDFHP-VAKK 469
                       *********************************************************99999**************************.7*** PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                         ++e ++L+ +pgEalaVn++l+lh+++desv+++++rd++L++vk l+Pkvv++veqe+++n+++F+ rflea++yy+a+f+sl+ +l+re
  Pp3c1_2540V3.7.p 470 GPEVEAWMLERQPGEALAVNFALHLHHMPDESVCTSNPRDRILHMVKALNPKVVTLVEQESNTNTAPFFPRFLEAMNYYAAIFESLDITLARE 562
                       ********************************************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       s+er++vE+++l+r+ivn++aceg +r+erhe ++kWr+rl++aGF+p+pls+++++++k+ll+ +++  yr+++e g+l+lgWk+r+L++ S
  Pp3c1_2540V3.7.p 563 SKERVNVEQQCLARDIVNIIACEGIDRVERHEMMGKWRARLTMAGFRPYPLSQTVNNTIKTLLESYSD-KYRLKDEGGALYLGWKNRSLIVSS 654
                       *******************************************************************5.5*********************** PP

              GRAS 372 aWr 374
                       aW+
  Pp3c1_2540V3.7.p 655 AWQ 657
                       **6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098571.629261638IPR005202Transcription factor GRAS
PfamPF035141.6E-139288657IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004871Molecular Functionsignal transducer activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MSVQYRPELG TMVLTPGYPP GKEREYLSDT ANSQQTPSYY GAQKSYADGQ RQSAYGMKNK  60
SHSSPVSPLS PQDSSQAASD NGQRMSAGWS SASYQSESSS HSDGSLEGPG KLEEADYYGR  120
QHRHGEQLTG SVAYHNTPSS VLRPMGYPAE TAQAYQMPNY QQAVRYIPEE QYAQSQSNYA  180
QRNPEMAHML QVLESALLDD DDGADLPGSL GNGHDPASEG NWADTIEEFM AADASPADSS  240
TVTSATTPPE YGKQCRNGST NNYTGAVTAR VEEPPPQKLV VGTRSRSEQL LVACAEALSN  300
NDMPLANVLI AQLNQVVSIY GDPMQRLAAY MVEGLVARVA ASGKGIYRSL KCKDPPTRDL  360
LSAMQILYEV CPYFKFGYMA ANGSIAEAFQ NESRVHIIDF QIAQGTQWTT LIQALAARPG  420
GPPHLRITGI DDPMPGPNSN AGVEMVGKRL AKLAEAVGVP FDFHPVAKKG PEVEAWMLER  480
QPGEALAVNF ALHLHHMPDE SVCTSNPRDR ILHMVKALNP KVVTLVEQES NTNTAPFFPR  540
FLEAMNYYAA IFESLDITLA RESKERVNVE QQCLARDIVN IIACEGIDRV ERHEMMGKWR  600
ARLTMAGFRP YPLSQTVNNT IKTLLESYSD KYRLKDEGGA LYLGWKNRSL IVSSAWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-7329465626378Protein SCARECROW
5b3h_A3e-7329465625377Protein SCARECROW
5b3h_D3e-7329465625377Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.17130.0gametophore| protonema
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379851.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379861.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379870.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379876.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379885.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379891.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379899.10.0scarecrow-like transcription factor PAT1
SwissprotQ8H1251e-174SCL5_ARATH; Scarecrow-like protein 5
SwissprotQ9LDL71e-175PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A2K1L6M10.0A0A2K1L6M1_PHYPA; Uncharacterized protein
STRINGPP1S346_13V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-177GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]