PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_24020V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 980aa    MW: 106238 Da    PI: 6.7848
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_24020V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.29.1e-21116171156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t+ q++e+e  F+++++p+ ++r++L+k lgL  rqVk+WFqNrR+++k
  Pp3c1_24020V3.1.p 116 KKRYHRHTPRQIQEMEMIFKECPHPDDKQRQQLSKDLGLAPRQVKFWFQNRRTQMK 171
                        688999***********************************************998 PP

2START204.93.3e-643115381206
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS..........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.........dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                        ela +a++elv++++aeep+Wv+      e++n++e++++f++  +          ++ea+r++++v m+ ++lve+lld + qW e+++  
  Pp3c1_24020V3.1.p 311 ELAVAAMEELVRMVQAEEPLWVRAGgggrEELNYEEYVRQFPRVVGmgmgmkpagLRTEASRETALVMMNGVNLVETLLDAS-QWAEMFPcv 401
                        57899*******************9****************99766************************************.********* PP

                        ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
              START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a t+ev+s+g      galqlm+aelq+lsplvp R+++f+Ry++q+ +g+w +vdvSv+s +++p  +s++R++++pSg li++++ng
  Pp3c1_24020V3.1.p 402 vsRAVTVEVLSTGvagnrnGALQLMYAELQVLSPLVPtREVYFLRYCKQHAEGVWGVVDVSVESLRDNP-PPSLMRCRRRPSGVLIQDTPNG 492
                        *********************************************************************.7********************* PP

                        EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        + +vt veh+++++r +h +++ lv+sg+a+ga++wvatl+rqce+
  Pp3c1_24020V3.1.p 493 YARVTCVEHAEYDDRAVHRMYKELVGSGMAFGAQRWVATLERQCER 538
                        ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.34E-1999173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2199167IPR009057Homeodomain-like
PROSITE profilePS5007117.038113173IPR001356Homeobox domain
SMARTSM003895.1E-20114177IPR001356Homeobox domain
CDDcd000867.45E-19115173No hitNo description
PfamPF000462.7E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084844.672302541IPR002913START domain
SuperFamilySSF559612.29E-35303540No hitNo description
CDDcd088752.46E-122306537No hitNo description
SMARTSM002347.6E-56311538IPR002913START domain
PfamPF018522.7E-54312538IPR002913START domain
SuperFamilySSF559616.18E-23560800No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    Send to blast
MRLGGVTVQV TPNGNLGGRG FAELGGMAPP RPIPPLISRP PPKHYTSPSL SLAPPSAMDR  60
QREIGQSAES ELQQQQQQQQ QQQQKNKEEE YGSRSGSDNM EGGSDDDQDA DHPPRKKRYH  120
RHTPRQIQEM EMIFKECPHP DDKQRQQLSK DLGLAPRQVK FWFQNRRTQM KAQTERAENS  180
LLRAENEKVR AENVIMREAL RKTQCPHCSV PATVGEMSLD EQQLRVENVR LKEELDRVSA  240
LAAKYLGRPI AGMGPVGVGS SSLELQVGGW LSGVQAGSAG GNADMVQGPS VAEVATRPGG  300
LTEAEKPMVV ELAVAAMEEL VRMVQAEEPL WVRAGGGGRE ELNYEEYVRQ FPRVVGMGMG  360
MKPAGLRTEA SRETALVMMN GVNLVETLLD ASQWAEMFPC VVSRAVTVEV LSTGVAGNRN  420
GALQLMYAEL QVLSPLVPTR EVYFLRYCKQ HAEGVWGVVD VSVESLRDNP PPSLMRCRRR  480
PSGVLIQDTP NGYARVTCVE HAEYDDRAVH RMYKELVGSG MAFGAQRWVA TLERQCERVA  540
SLLASNIAPR DLGGVPSASG RRSMLKLAQR MTSNFCAGVS ASTAHTWTTL SGSGDDDVRV  600
MTRKSVDNPG EPQGIVLSAA TSMWLAVSAA RVFEFLRDER LRSEWDILSN GGMVTEMAHI  660
AKGRDPGNSV SLLKVNAMNA NNSNMLILQE SCTDVSGSLV IYAPVDIPAM NLVLQGGDPA  720
YVALLPSGFA ILPDGPGGGE RSGCGGEQAG QGAESGRGAG RGSLVTVAFQ ILVSSVPSAR  780
LSLESVATVN NLISCTVQRI RAALVAEEEE QRGWALRSVQ DCVSSHIERG LERSSGGKGG  840
DQEQDQEQVR SRVAEEDDGD GGGRYGGDVR VWDLGDEQGQ RRGRIGRERK RVKSEPPVMA  900
LVAWRGGMSA PGGTRRIPWR GGMVAQWREQ SGACATPRRQ GSGSGIDRVP GVPRWICTSM  960
WKDAGANLVF DSFADFGSL*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024390340.10.0homeobox-leucine zipper protein HDG2-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A2K1L9I50.0A0A2K1L9I5_PHYPA; Uncharacterized protein
STRINGPP1S59_146V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]