PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_15680V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 770aa    MW: 84295.9 Da    PI: 6.7861
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_15680V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS434.76.9e-1334077671373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        lv+lLl+cA+a+s+++ e a++ L++l  +as  gd+mqR+aa+fteALaar++++ +  yk l  ++      ++ l+a++++++++P+++
  Pp3c1_15680V3.1.p 407 LVHLLLACADAISKNKIEIATQKLEELYSHASLFGDSMQRIAAFFTEALAARIVGKDNPAYKNLMLQSH----LDDYLSAFTTLYKICPYFQ 494
                        68*****************************************************99999998876665....79***************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        f+h+taNqaIleaveg + vHiiD+d++qG+QWp ++q+L++R++gpp+l+iTgvg     s ++l+ tg+rLa fAe+ gvpfef++ v+ 
  Pp3c1_15680V3.1.p 495 FGHFTANQAILEAVEGYSVVHIIDMDLMQGFQWPGFIQSLSEREGGPPKLKITGVGT----SCTSLQDTGRRLAAFAETYGVPFEFHA-VVG 581
                        *********************************************************....9**************************.799 PP

               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        +ledl++ eL  kpgEa+aVn+v+qlhrll++  +l++    +++ ++s+ P ++++veqea+hn++sF+ rf+eal+yy+a+fdsl+++lp
  Pp3c1_15680V3.1.p 582 ELEDLSPMELGAKPGEAVAVNCVMQLHRLLNNGDKLQN----FISGLRSIHPVMLTLVEQEANHNTSSFMGRFVEALHYYAAVFDSLDSSLP 669
                        9*****************************88888888....************************************************** PP

               GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.sgslvlgWkdrpL 367
                         +seer+k+E+ +++++i+n+vacega+r+erhetle W++r++ aGF++ pls++ ++qaklll+  + dgy + ++  gs+ l W+dr+L
  Pp3c1_15680V3.1.p 670 LASEERAKIEQLYFAQQIKNIVACEGADRIERHETLELWQKRMKLAGFRQWPLSSHSVTQAKLLLSLSPCDGYCLSQQpGGSISLNWQDRSL 761
                        ***************************************************************************987255566******** PP

               GRAS 368 vsvSaW 373
                        +++S W
  Pp3c1_15680V3.1.p 762 LTASTW 767
                        ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.281381747IPR005202Transcription factor GRAS
PfamPF035142.4E-130407767IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MMPPFGSLLE PPTNLRGGQS SFYVKQEPGV DSVRKLRMDT PQSAFSSYRD THPTLRKPLQ  60
HELSAFGPFS AQGQSSMDAS TSNAAPHPPS GDTHTSLRKS ASRQPIQVHQ YLRPAVLQPT  120
TSVSPSKKQC TEKSRQFNDV FLSAHTNAMP SKSSDVGSSG LATGIRDTTS DGFVVVSCKQ  180
MQCKQECDIA STSFSAPPLS RKRSHSELAE ESCDSELVLG VGGRSSVSRE GSEYRNSRAS  240
SPRKSQKSSD TRLDLVSADL CLAPPIVAPE YSSSSSQQEA PSSSMLETQP LGESSKVSHS  300
RGTYVSPTQS HLSFQKIKSK DVSRAEGVTC ISQAESHPTG SRCQQPVRPL LNLEVIKREC  360
DAVERERDNE ESLAQSRNHH EGFELGLFPG VFAADQGKKS EASGLQLVHL LLACADAISK  420
NKIEIATQKL EELYSHASLF GDSMQRIAAF FTEALAARIV GKDNPAYKNL MLQSHLDDYL  480
SAFTTLYKIC PYFQFGHFTA NQAILEAVEG YSVVHIIDMD LMQGFQWPGF IQSLSEREGG  540
PPKLKITGVG TSCTSLQDTG RRLAAFAETY GVPFEFHAVV GELEDLSPME LGAKPGEAVA  600
VNCVMQLHRL LNNGDKLQNF ISGLRSIHPV MLTLVEQEAN HNTSSFMGRF VEALHYYAAV  660
FDSLDSSLPL ASEERAKIEQ LYFAQQIKNI VACEGADRIE RHETLELWQK RMKLAGFRQW  720
PLSSHSVTQA KLLLSLSPCD GYCLSQQPGG SISLNWQDRS LLTASTWVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-8441476726378Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024398966.10.0scarecrow-like protein 1
RefseqXP_024399048.10.0scarecrow-like protein 1
TrEMBLA0A2K1L8B60.0A0A2K1L8B6_PHYPA; Uncharacterized protein
STRINGPP1S63_181V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53661322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-95RGA-like 1