PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_15560V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 819aa    MW: 90248 Da    PI: 5.143
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_15560V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.41e-1334347971374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        lv+lL++cAeavs+++l+l+++lL++l e+asp+g++mqR+aayfte+La r+a+ ++++y+ lp+ ++   n ++  +a++l+++v P+ k
  Pp3c1_15560V3.3.p 434 LVTLLIACAEAVSTQSLSLVNHLLQKLGEHASPQGTAMQRVAAYFTEGLACRVAHLWPHVYQPLPTHSNL--NDEQLQTAFHLLNHVVPYTK 523
                        6789*********************************************************999887776..4566667999********** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                        f+h+t N  Il+a++g++rvH+iDfdi+qGlQWpaL+q+La+R+ gpp ++RiTg+g+     k+ l etg+rLa+fAee+++pf+f++ v 
  Pp3c1_15560V3.3.p 524 FAHFTVNDIILQAFNGADRVHVIDFDIKQGLQWPALFQSLAERECGPPsHIRITGIGE----CKDDLLETGDRLAEFAEEFNIPFSFHA-VI 610
                        ********************************************66665*********....***************************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +rled++l++L+vk++Ea+aVn++ q hrll +s+++ +   ++L+l+ s++P+vv +veqe +hns+ F  rfle+l+yysa+fdslea+l
  Pp3c1_15560V3.3.p 611 DRLEDVRLWMLHVKENEAVAVNCISQFHRLLYDSGETIK---DFLNLIGSTKPRVVAIVEQEGSHNSPHFEGRFLESLKYYSAIFDSLEANL 699
                        *******************************99999999...9************************************************* PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        +res  r+ vE+  ++ ei+n+++cegaer+erhe  ++W+  l+++ F +vpl+++a++qa+ llr+++sdgy++  e+gsl+lgW ++pL
  Pp3c1_15560V3.3.p 700 SRESCVRVQVEQL-FALEIRNILSCEGAERVERHEDTARWSVLLSQSDFVNVPLEDSANTQAQILLRMFDSDGYTLTAENGSLTLGWVEQPL 790
                        ***********98.****************************************************************************** PP

               GRAS 368 vsvSaWr 374
                        ++vSaW+
  Pp3c1_15560V3.3.p 791 LTVSAWK 797
                        ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.731408777IPR005202Transcription factor GRAS
PfamPF035143.6E-131434797IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MREIGVLEYG EMLYTGELDE LFRLPAVKTG RSSSPSLPCS NASSQYGLHS QRSELGLSGS  60
PSHRGGMSGN NRVLLPGKFV LKKGLEPWST VERRGEQLSS TDPAGSPSFR RAGTTMWPDK  120
TSTACEAETS TGQWTSPRCG EDPRNEGDLI HFHQHQNQST SNSPLCPGTP IRHHYSQMAP  180
SSPLQIISSP DVKKCIAPMS EPRSVLDLTI SPQQHQLPTI RATLPRRFRE TFLEHNVAPV  240
TAPSLSPSPR VLNFESCSNG STKSGTFADQ YGPSPTNAST WAPDLATQGY PTSIPTHKVE  300
ELPVLPTAQS FIQETSSLDE WEAATITSPQ HKLRAKQWMV SLMEDLRNAE DANSAQETEE  360
CTTPFTPGVD SCAPYFLTSQ NGLGSPCPSD YTGDDTPRGS RLEHLQVESP CGTPRGGGDG  420
EDAQNSPVMV GHELVTLLIA CAEAVSTQSL SLVNHLLQKL GEHASPQGTA MQRVAAYFTE  480
GLACRVAHLW PHVYQPLPTH SNLNDEQLQT AFHLLNHVVP YTKFAHFTVN DIILQAFNGA  540
DRVHVIDFDI KQGLQWPALF QSLAERECGP PSHIRITGIG ECKDDLLETG DRLAEFAEEF  600
NIPFSFHAVI DRLEDVRLWM LHVKENEAVA VNCISQFHRL LYDSGETIKD FLNLIGSTKP  660
RVVAIVEQEG SHNSPHFEGR FLESLKYYSA IFDSLEANLS RESCVRVQVE QLFALEIRNI  720
LSCEGAERVE RHEDTARWSV LLSQSDFVNV PLEDSANTQA QILLRMFDSD GYTLTAENGS  780
LTLGWVEQPL LTVSAWKPDK DFVLTGKSLV TNEKQQAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A8e-8244179826380Protein SCARECROW
5b3h_A7e-8244179825379Protein SCARECROW
5b3h_D7e-8244179825379Protein SCARECROW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109581e-101gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394262.10.0scarecrow-like protein 28
RefseqXP_024394277.10.0scarecrow-like protein 28
TrEMBLA0A2K1L8B70.0A0A2K1L8B7_PHYPA; Uncharacterized protein
STRINGPP1S63_198V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-120GRAS family protein