PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_15410V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family B3
Protein Properties Length: 639aa    MW: 70361.3 Da    PI: 7.7806
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_15410V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.52.7e-1442128598
                        -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                        lt sdv++ ++  +p++f e++g + +++  +++   +g++W+v++   +  +   +++GW++Fv +n Lk gD v+F l+++++f   v v
  Pp3c1_15410V3.1.p  42 LTASDVSS-NWTPVPREFSESYGDDLRGP--VSFHGANGKVWSVEV--GGPAKFLGFKGGWRSFVADNSLKRGDQVLFLLVSTKTF--SVYV 126
                        44555555.57999********9887776..***************..88888899***********************9998888..8877 PP

                        E- CS
                 B3  97 fr 98 
                        f+
  Pp3c1_15410V3.1.p 127 FN 128
                        76 PP

2B360.43.1e-19294384498
                        E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                 B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                        v++ps+v +  +l++p kf ++h  +    + ++l+d +g +W+      k++ ++  ++GW  F ++++L+egD++vF+++++++ + +v+
  Pp3c1_15410V3.1.p 294 VMMPSHVYRGFWLTIPGKFSKAHLPN--DRINIKLQDIHGFQWSASW--IKSDHHTGVSGGWAAFSRDHRLEEGDVCVFEVIDSEDWTILVH 381
                        799********************533..5578***************..999999999***********************9999999**** PP

                        EE- CS
                 B3  96 vfr 98 
                        +fr
  Pp3c1_15410V3.1.p 382 IFR 384
                        *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.8337130IPR003340B3 DNA binding domain
CDDcd100171.35E-1438128No hitNo description
SMARTSM010191.0E-1039130IPR003340B3 DNA binding domain
SuperFamilySSF1019368.04E-2040132IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.9E-1941128IPR015300DNA-binding pseudobarrel domain
PfamPF023624.1E-1242128IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.4E-21286384IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-24289387IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.943291386IPR003340B3 DNA binding domain
SMARTSM010194.6E-15291386IPR003340B3 DNA binding domain
PfamPF023629.0E-18294384IPR003340B3 DNA binding domain
CDDcd100173.96E-23294384No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MSEAMDSAFR ACVPCTHSCY NKHRNIAAES TTPFTRPPCF LLTASDVSSN WTPVPREFSE  60
SYGDDLRGPV SFHGANGKVW SVEVGGPAKF LGFKGGWRSF VADNSLKRGD QVLFLLVSTK  120
TFSVYVFNKL GVETIPSPCV TPMRAAPMSG KRKREDVNDE AGMNVRVKDE AEDLDAESSD  180
ISEYEASDTD SSSESEDTEA SPQHSGGKVY NDEVCFPVKM KVRRKCTAKV SRVNAHPTKK  240
SVGGSAGKDG MMYEAGSCSR TYESLRRKVT LAERERALVA ANAFVTEGPS CPVVMMPSHV  300
YRGFWLTIPG KFSKAHLPND RINIKLQDIH GFQWSASWIK SDHHTGVSGG WAAFSRDHRL  360
EEGDVCVFEV IDSEDWTILV HIFRVVDVDL APGSRGGWDK NYRIIQPKIH YHPKTREKHL  420
TKKTSSGTAK RNLTGASYST PSRRQMSKRY KKAPNPEQSD AEDDEDALLS TLCKGNSAAV  480
SDVEDVKPKI LSMGPIPQIV KVKQEPNLPA MCNVKQEYGM CSEDMKPTAE KLKASLNLSQ  540
PPRDPICEIV KNAGVPAVAK SESGATEPSL NNDARTWYAV VRLLNKRQNE ETSELELLVT  600
IRACPRTAES SGVSTDGNGN WWVPRSHFSP DMASCYIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A5e-1726238517142B3 domain-containing transcription factor VRN1
4i1k_B5e-1726238517142B3 domain-containing transcription factor VRN1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.177360.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024384027.10.0B3 domain-containing protein Os11g0197600-like
RefseqXP_024384107.10.0B3 domain-containing protein Os11g0197600-like
RefseqXP_024384185.10.0B3 domain-containing protein Os11g0197600-like
RefseqXP_024384260.10.0B3 domain-containing protein Os11g0197600-like
RefseqXP_024384342.10.0B3 domain-containing protein Os11g0197600-like
RefseqXP_024384433.10.0B3 domain-containing protein Os11g0197600-like
RefseqXP_024384516.10.0B3 domain-containing protein Os11g0197600-like
TrEMBLA0A2K1L8C80.0A0A2K1L8C8_PHYPA; Uncharacterized protein
STRINGPP1S63_211V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-26B3 family protein