PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_8310V3.1.p
Common NameDELLAa, GAL2, PHYPADRAFT_235433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 554aa    MW: 60921.2 Da    PI: 6.5075
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_8310V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.62.7e-1281845511374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalkl.fsevsPi 90 
                        lv+ Ll+cAe ++ g+l+ a+++L r++ l+ p g pm ++a++f  AL +r+++    ++++  + s++  ++s++ l  l++ f+e +P+
  Pp3c19_8310V3.1.p 184 LVHSLLACAESIQRGNLSFAEETLRRIELLSLPPG-PMGKVATHFIGALTRRIYG----VASSSgNNSSS--NQSDSLLGLLHFyFYESCPF 268
                        689*************************9998876.9******************....32222133333..3444444444445******* PP

               GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                        l+f+h+taNqaIleav g ++vH+iDf+++qGlQWpaL+qaL+ R++gpp+lR+Tg+g+p+++ +++l+e+g +La++A++++v+fef+ ++
  Pp3c19_8310V3.1.p 269 LRFAHFTANQAILEAVTGLKEVHVIDFNLMQGLQWPALIQALSLRQGGPPRLRLTGIGPPQPSGSDTLQEIGTKLAELAKTVRVDFEFRGVI 360
                        ******************************************************************************************** PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.ea 273
                        a +l+d+++++L++++gEa+aVn+vlqlh+ll + ++ +  +d+vL lv++l+Pk++++ve+ea+hn++sFl rf+eal+yys++fd+l + 
  Pp3c19_8310V3.1.p 361 AVKLDDIKPWMLQIRHGEAVAVNSVLQLHKLLYSAGPEAP-IDAVLLLVRELKPKIFTIVEHEANHNQPSFLGRFIEALHYYSTMFDALeAC 451
                        ********************************77777766.************************************************788 PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                        +lp+e++e++ +E   lgrei n+vace  +r+erhe+l +Wr rl +aG++p++l+ +a kqa++ll +++++gyrvee+ g+l+lgW++r
  Pp3c19_8310V3.1.p 452 NLPSENNEQVLIEMY-LGREIYNIVACEDGARTERHENLFQWRLRLLKAGYRPIQLGLNAFKQASMLLTMFSGEGYRVEEKLGCLTLGWHSR 542
                        999999999999977.**************************************************************************** PP

               GRAS 366 pLvsvSaWr 374
                        pL+++SaW+
  Pp3c19_8310V3.1.p 543 PLIAASAWK 551
                        ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.221158531IPR005202Transcription factor GRAS
PfamPF035149.4E-126184551IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016874Molecular Functionligase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MAYQYSPGGS RWKPTGGTLV DGRLRHDKFT QASDAVQQLE ELHTSLGSVS QDSLNIPAYY  60
TLGSSSQAVS NCSTDLAGWI DCMIEELSSN TACPIMAPQQ QHGLLEGSFL KNDHDASSCR  120
DSLLETGSHR LSNVQFQDTS AARNKSSTAP HNGTSQVNAI RTTAAGLEQQ LNKMGEDENN  180
GIQLVHSLLA CAESIQRGNL SFAEETLRRI ELLSLPPGPM GKVATHFIGA LTRRIYGVAS  240
SSGNNSSSNQ SDSLLGLLHF YFYESCPFLR FAHFTANQAI LEAVTGLKEV HVIDFNLMQG  300
LQWPALIQAL SLRQGGPPRL RLTGIGPPQP SGSDTLQEIG TKLAELAKTV RVDFEFRGVI  360
AVKLDDIKPW MLQIRHGEAV AVNSVLQLHK LLYSAGPEAP IDAVLLLVRE LKPKIFTIVE  420
HEANHNQPSF LGRFIEALHY YSTMFDALEA CNLPSENNEQ VLIEMYLGRE IYNIVACEDG  480
ARTERHENLF QWRLRLLKAG YRPIQLGLNA FKQASMLLTM FSGEGYRVEE KLGCLTLGWH  540
SRPLIAASAW KCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-541845514375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2627500.0EU262750.1 Physcomitrella patens DELLA-like protein mRNA, complete cds.
GenBankEF6464720.0EF646472.1 Physcomitrella patens DELLA protein (DELLAa) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001774314.10.0AtGAI1 GRAS E3 ubiquitin ligase protein
TrEMBLA7U4T60.0A7U4T6_PHYPA; AtGAI1 GRAS E3 ubiquitin ligase protein
STRINGPP1S175_16V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-141GRAS family protein
Publications ? help Back to Top
  1. Yasumura Y,Crumpton-Taylor M,Fuentes S,Harberd NP
    Step-by-step acquisition of the gibberellin-DELLA growth-regulatory mechanism during land-plant evolution.
    Curr. Biol., 2007. 17(14): p. 1225-30
    [PMID:17627823]
  2. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]