PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_19610V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 266aa    MW: 27453.8 Da    PI: 8.7421
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_19610V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.41.6e-45311301100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasn++kll++lp ++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++ql+
  Pp3c19_19610V3.1.p  31 PCAACKFLRRKCTSECVFAPYFPPDQPHKFANVHKIFGASNITKLLNELPMHQREDAVNSLAYEADARVKDPVYGCVGAISVLQRQVAQLQ 121
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +ela +++ 
  Pp3c19_19610V3.1.p 122 NELAIAHSD 130
                         ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.12530131IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4431128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MRVVVQERID GFRDALSTTM KRGMASSSSS PCAACKFLRR KCTSECVFAP YFPPDQPHKF  60
ANVHKIFGAS NITKLLNELP MHQREDAVNS LAYEADARVK DPVYGCVGAI SVLQRQVAQL  120
QNELAIAHSD LARYASAGMV VPSVGQGGAS SSLGVGMNLS RGQPNREQML TREQLMDLAR  180
DPSHLSREHL MELARGGGGS YETLQALGLS GALGPLGPFP SNPRPGGESG NRSGGEGGNG  240
GGGGRGGGGG GGASGSNTGG QVTSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-603013610116LOB family transfactor Ramosa2.1
5ly0_B2e-603013610116LOB family transfactor Ramosa2.1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242250GGRGGGGGG
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024356367.10.0protein LATERAL ORGAN BOUNDARIES-like isoform X1
SwissprotQ9FML49e-60LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A2K1IZ190.0A0A2K1IZ19_PHYPA; Uncharacterized protein
STRINGPP1S170_93V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.46e-60LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]