PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_19400V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 231aa    MW: 24081 Da    PI: 8.4932
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_19400V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.81.2e-4581071100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++lp+++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++ql+
  Pp3c19_19400V3.2.p   8 PCAACKFLRRKCTSECVFAPYFPPDQPHKFANVHKIFGASNVTKLLNELPTHQREDAVNSLAYEADARVKDPVYGCVGAISVLQRQVAQLQ 98 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la++++ 
  Pp3c19_19400V3.2.p  99 NDLASAHSD 107
                         ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0597108IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MASSSSSPCA ACKFLRRKCT SECVFAPYFP PDQPHKFANV HKIFGASNVT KLLNELPTHQ  60
REDAVNSLAY EADARVKDPV YGCVGAISVL QRQVAQLQND LASAHSDLAR YAAAGMVVPS  120
VDQGVSSSLG LRTSLSQGHA SREQMLTREQ LMDLARADPS HLSREHLMEL ARVGGGSYET  180
LQALGLSGAL GPLRASASNF RPGGEGRNRS GSGTGGGVSG SNAGGQIASP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-61711210115LOB family transfactor Ramosa2.1
5ly0_B3e-61711210115LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403438.11e-168LOB domain-containing protein 6-like
TrEMBLA0A2K1IZ181e-166A0A2K1IZ18_PHYPA; Uncharacterized protein
STRINGPP1S170_78V6.11e-167(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-60LOB domain-containing protein 25