PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_19050V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 446aa    MW: 48776.1 Da    PI: 9.0528
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_19050V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-39107167262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +++ ++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg+rknk+++
  Pp3c19_19050V3.2.p 107 PDQVIACPRCQSLNTKFCYYNNYSLTQPRHFCKSCRRYWTAGGTLRNVPVGGGCRKNKRTK 167
                         68899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-26107165IPR003851Zinc finger, Dof-type
PfamPF027011.9E-33108165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.217111165IPR003851Zinc finger, Dof-type
PROSITE patternPS013610113149IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MIAAFGGARV PDNLSSFGRD IRFHPWEQHG QLAFTNQAGP SKAQGYMVNV QTPLMSVAVL  60
GHGDWAMIPS SSNHEQQQQQ AQLQQQEKKA SQLFAQRALQ ERRLKPPDQV IACPRCQSLN  120
TKFCYYNNYS LTQPRHFCKS CRRYWTAGGT LRNVPVGGGC RKNKRTKPRT PEGQNGRTGS  180
ADGDSMSVPV LQHPGFNSTS IDFLSSSEGS AFGSADPSMR ADSPMCQSTE GGLPMFHPGA  240
QSSSIAQHQL PQPFDSGIPG LNFFRNANRV PGTTLNLHPT FQMPTGDLSE MFDTSNAPRV  300
GALSTLSEGL GTFNINPKSG RDQQSLMSLE RWQAASKQHA PSGIWGLPEM AQAQANADMS  360
RHQDAKGKMT LAMAPASGMD APKRSQQQQQ QQQHQQRPTP SWEHSNPQEN PGLHYEQQSE  420
QNYWRNPGGW PSTEAFQSSG GGQAL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.74090.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024356393.10.0dof zinc finger protein DOF1.4-like isoform X1
RefseqXP_024356394.10.0dof zinc finger protein DOF1.4-like isoform X1
RefseqXP_024356395.10.0dof zinc finger protein DOF1.4-like isoform X1
RefseqXP_024356396.10.0dof zinc finger protein DOF1.4-like isoform X1
TrEMBLA0A2K1IYZ10.0A0A2K1IYZ1_PHYPA; Uncharacterized protein
STRINGPP1S170_42V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-34TARGET OF MONOPTEROS 6