PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_18560V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 816aa    MW: 90003.4 Da    PI: 6.0986
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_18560V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS175.63.8e-544936422157
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                           lLl+cAeavss+d+ +a+++L +lsela+p+g+++qR++ayf+e++a+rl+  + +++  l++++    + ++ l+a+++f+e++P++k
  Pp3c19_18560V3.1.p 493 LALLLQCAEAVSSDDFDQANSILPQLSELATPYGTSVQRVVAYFAEGMASRLVTYCLGICPPLSSKQLV--SNQSFLSAMQVFNEICPFVK 581
                         579*********************************************************999888887..4778999************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskee 157
                         fsh+taNqaI +a+eg   vH+iD+di++GlQWp+L+q LasRp+gpp++ iTg+g     s e+
  Pp3c19_18560V3.1.p 582 FSHFTANQAIFDAFEGMFNVHVIDIDIMHGLQWPPLFQLLASRPGGPPHVHITGLGT----SIET 642
                         *******************************************************99....4444 PP

2GRAS144.88.4e-45644813197374
                GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                         +  +a+aV++++  h+l+d ++s  +    +L+l+ +l+Pkv+++veq++ h +++Fl rf+eal+yysalfdsl a++ ++s er++vE+
  Pp3c19_18560V3.1.p 644 EATDAVAVHWMH--HSLYDVTGSDLN----TLNLIEKLNPKVITLVEQDLRH-GGTFLSRFVEALHYYSALFDSLGASYKADSPERHMVEQ 727
                         457999****99..999999999999....**********************.789*********************************** PP

                GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         +ll+ ei+n++a  g +r+ + + + +Wr+ l++  Fkpv+ls kaa qa lll+     +gy++ e++g+l lgWkd  L+++SaW+
  Pp3c19_18560V3.1.p 728 QLLSCEIKNILAFGGPARTGEAK-FDQWRDELGKR-FKPVSLSGKAAHQAALLLQGLFpCEGYTLLEHRGTLKLGWKDLYLFTASAWT 813
                         *****************888766.********986.*******************9877****************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.078466815IPR005202Transcription factor GRAS
PfamPF035141.3E-51493642IPR005202Transcription factor GRAS
PfamPF035142.9E-42644813IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MALVCPNPRE RLGLVTKEPT GVGSRTHYNV GFPGYRDQLR MTDNLRDPFH SGPETGGRDP  60
QDAERRGELQ EHRVHLPDLD FGVGAKWNCT GQISSWSSYD STSQSFPSTS AAGWVVSPLG  120
SNNSPFPSDG SFSDHLSSGL SNTSFPGALP ASLQVQSGGS AGGFFSGSTQ TASCNGNQLY  180
QNPPSLMNAA PRDSWGKIED APSPHHQLSC QYDMEQHGNY GYGVQPAREA VKDHFSGMDE  240
DSVAAWVDGM IMEMMEAMPG VPIEQILTNL SEVLAPSNSQ LERIIGSRVQ SLYGGAGLRV  300
QTFLHTGPSR FGKRTREGQI GWRNAKSSQN EARAYQDTPS HHHVRPDNFM EQNAVASLAR  360
DELHYPRPQK RTIDNLQLSL EPADERSLRH LHTAQQPMPE DQYSHQVLRS RDQTTKPVQH  420
QHYFQPHLQH QQQKSGEIQN DFSPPSNAAQ YPILNTRGFN DAVSLPQNVP QSTPRNAQPE  480
PPNATDEEGL QLLALLLQCA EAVSSDDFDQ ANSILPQLSE LATPYGTSVQ RVVAYFAEGM  540
ASRLVTYCLG ICPPLSSKQL VSNQSFLSAM QVFNEICPFV KFSHFTANQA IFDAFEGMFN  600
VHVIDIDIMH GLQWPPLFQL LASRPGGPPH VHITGLGTSI ETLEATDAVA VHWMHHSLYD  660
VTGSDLNTLN LIEKLNPKVI TLVEQDLRHG GTFLSRFVEA LHYYSALFDS LGASYKADSP  720
ERHMVEQQLL SCEIKNILAF GGPARTGEAK FDQWRDELGK RFKPVSLSGK AAHQAALLLQ  780
GLFPCEGYTL LEHRGTLKLG WKDLYLFTAS AWTNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-13848681313379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403515.10.0protein SCARECROW-like
TrEMBLA0A2K1IYZ00.0A0A2K1IYZ0_PHYPA; Uncharacterized protein
STRINGPP1S882_1V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-130GRAS family protein