PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_16060V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 728aa    MW: 81804.5 Da    PI: 5.9523
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_16060V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.99.4e-1113507182373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lLl+cA +vs++d + a+ l+ +l+ ++s +g+++qR+a y++eAL a++++++++ly a+++++ s   +++ l+a++lf++ sP++k
  Pp3c19_16060V3.2.p 350 KTLLLKCAFVVSKDDVRTANDLIRELRMHSSVHGTALQRMAYYYMEALVAKMSGTGPQLYMAITSNTPS---TATMLKAHRLFVDYSPYIK 437
                         789*********************************************************999999988...8999*************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++h+   ++Il+a+eg++rvH +D+++ +G+QWp+L+q L++R++gpp+lRiT ++ p++g   + +++e+g rLa+fA+  +vpfefn+ 
  Pp3c19_16060V3.2.p 438 VTHFFSTKTILDAFEGADRVHLVDYGVAYGAQWPCLIQRLSQRKGGPPHLRITCIDLPQPGgkVSARVKEVGCRLAEFAQLWEVPFEFNA- 527
                         ************************************************************999999************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a+++e+++  +L+++++E+laVn++++l +lldes   +s+r+ +L+ ++ ++Pkv+++   +a++n++ F++rf e+++yy ++fd++e
  Pp3c19_16060V3.2.p 528 LADKWESITSAHLNLNQDEVLAVNCQYRLRNLLDESIMAASPRKLLLEKIRFMNPKVFIMLTVNANYNAPFFMTRFRESMKYYFTMFDAME 618
                         6****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         +++p+++ +r+ +Ere+ grei n+vaceg er+er e +++W+   ++aGF++ pls  +a+++k+++  +++d y v e+  ++++gWk
  Pp3c19_16060V3.2.p 619 VSMPANDPDRVILEREFYGREILNIVACEGVERVERAEPYRQWQTLTQRAGFTQKPLSPIIASKIKAMMGSYHKD-YGVGEDGSWFLMGWK 708
                         *************************************************************************77.*************** PP

                GRAS 364 drpLvsvSaW 373
                         ++ + ++++W
  Pp3c19_16060V3.2.p 709 NQIVRAMTVW 718
                         ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.331323700IPR005202Transcription factor GRAS
PfamPF035143.3E-108350718IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MLGTRQSRSG ALARETSPLA SQLQQAWLQS QIQSQAPKHQ KRGFTTLGED DVSVQNRVVQ  60
QFHQVASDLS SIVADHANHT GFPNVVEKEE LYFHKTRLEM PEFPRRPETP QLVSYSRKAD  120
KPQKPRSGNF LERRSSSYSS LSSASSGSLS PTSTVSFESV QLHQEFDAPL DVADYAISGT  180
LDLACQSEPL VRFLDGMLAE DNMDGKKFTL QEGFDYHAIA KEFDDIARPN LASEYGSSDF  240
ADGDYDMSWA SMGILPTEEA VADKLIHAYT SNLNKHVTDV SENVDSSTWV NEGDACTDHS  300
DQSWDWYLER LRPNPTGRSL SSSIFQGDSL GQDMSPDALS AFPAVCVDLK TLLLKCAFVV  360
SKDDVRTAND LIRELRMHSS VHGTALQRMA YYYMEALVAK MSGTGPQLYM AITSNTPSTA  420
TMLKAHRLFV DYSPYIKVTH FFSTKTILDA FEGADRVHLV DYGVAYGAQW PCLIQRLSQR  480
KGGPPHLRIT CIDLPQPGGK VSARVKEVGC RLAEFAQLWE VPFEFNALAD KWESITSAHL  540
NLNQDEVLAV NCQYRLRNLL DESIMAASPR KLLLEKIRFM NPKVFIMLTV NANYNAPFFM  600
TRFRESMKYY FTMFDAMEVS MPANDPDRVI LEREFYGREI LNIVACEGVE RVERAEPYRQ  660
WQTLTQRAGF TQKPLSPIIA SKIKAMMGSY HKDYGVGEDG SWFLMGWKNQ IVRAMTVWEP  720
TSATTVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-5035572225382Protein SCARECROW
5b3h_A1e-5035572224381Protein SCARECROW
5b3h_D1e-5035572224381Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.43460.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403964.10.0scarecrow-like protein 33
TrEMBLA0A2K1IYM30.0A0A2K1IYM3_PHYPA; Uncharacterized protein
STRINGPP1S20_86V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-118SCARECROW-like 14