PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c18_11300V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Trihelix
Protein Properties Length: 758aa    MW: 83758.8 Da    PI: 7.9245
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c18_11300V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix101.19e-32242326187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laLi++r++m+ ++r++ lk+plWe+vskk++e g++rs+k+Ckek+en++k+ykk+k+g+ +r  ++ +++++f+qlea
  Pp3c18_11300V3.1.p 242 RWPRQETLALIKIRSDMDANFRDSGLKGPLWEDVSKKLAELGYNRSAKKCKEKFENVHKYYKKTKDGRAGR--QDGKNYRFFSQLEA 326
                         8********************************************************************97..66678*******85 PP

2trihelix106.22.2e-33570654186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k evl+Li++r++me+r++++  k+plWee+s+ m+  g++r++k+Ckekwen+nk+++k+ke++kkr +e+ +tcpyf+qle
  Pp3c18_11300V3.1.p 570 RWPKPEVLTLIKLRSDMESRFQEAGPKGPLWEEISQGMACLGYNRNQKRCKEKWENINKYFRKTKESNKKR-PENAKTCPYFHQLE 654
                         8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.1E-4239301IPR001005SANT/Myb domain
PROSITE profilePS500906.829241299IPR017877Myb-like domain
CDDcd122031.80E-31241306No hitNo description
PfamPF138375.4E-22241327No hitNo description
SMARTSM007170.0093567629IPR001005SANT/Myb domain
PfamPF138375.4E-22569654No hitNo description
CDDcd122034.50E-33569634No hitNo description
PROSITE profilePS500907.062570627IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MQNTGQYGVS DSPQFVVGRP PAHIFSISHD NMSISSPSAG HPLPGHHPQH HLPHHLQAQH  60
HHYGPHPGHQ PHPTLQAHQQ IHQTQSPHAA HAPHPQHPQF PLAQHPQGQQ QQQPAQPHQP  120
SLHQDVAQHQ QAQQQAQQQQ AQQQAQQQQQ QQQAQQQVQQ QAQQVQQVQQ AQQAQQQAQQ  180
AAQQAQQQMV QQLGLGGPDS PEVPSPGVSR PSPTNYSQQQ IVSAAQDDDG LEEEGRSTGA  240
NRWPRQETLA LIKIRSDMDA NFRDSGLKGP LWEDVSKKLA ELGYNRSAKK CKEKFENVHK  300
YYKKTKDGRA GRQDGKNYRF FSQLEALYGG QQTSAQLESN VAEVAVASLL AGSTVPGIAA  360
TDDYNISAPR PSEVSTGVTL SDSSEDDYDE LGSGEADNQE KSRKRKRMEG GKSGTSKLDY  420
FESLMKNLMD KQESMQRKFL EFMERREQDR QVREEAWRRQ EIARMAREHE LRAQEHALAA  480
TRDAALVAFL QKVTGQTLQI PQFPSRPPIV TVPPSIDSVV AAAQKQQSTP TPVTPVPAPA  540
APPTTASQQL VVANVDDIDK DSPIDPNSKR WPKPEVLTLI KLRSDMESRF QEAGPKGPLW  600
EEISQGMACL GYNRNQKRCK EKWENINKYF RKTKESNKKR PENAKTCPYF HQLEVLYRQG  660
VLGTPNNKQV SKVSADSPAR ELVDHQAVPL AHRIEAAAGK GGDTEMLKML PAAAEAVQNA  720
ASAGNGTPSA AVHFFSSPEN GSSAERGGPK QGSEPSM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024402443.10.0trihelix transcription factor GTL1-like
TrEMBLA0A2K1J0Q10.0A0A2K1J0Q1_PHYPA; Uncharacterized protein
STRINGPP1S19_341V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-100Trihelix family protein