PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c18_11190V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Trihelix
Protein Properties Length: 499aa    MW: 56209.1 Da    PI: 7.2969
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c18_11190V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.64.4e-30217301187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++ e+laLi++r+++++++r++  k+plWe+vs+k++e g++rs k+Ckek+en++k+ykk k+g+ +r++++s  +++f ql+a
  Pp3c18_11190V3.1.p 217 RWPRAETLALIQIRSDLDSSFRDSGVKGPLWEDVSRKLAEMGYNRSGKKCKEKFENIHKYYKKSKDGRAGRQDGKS--YRFFAQLDA 301
                         8*********************************************************************866665..******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122034.48E-31216281No hitNo description
PROSITE profilePS500906.69216274IPR017877Myb-like domain
PfamPF138377.5E-22216302No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MQRTGHYGLS DSPQFLVARG PPPHMFSLSH DNISLSPPAG HAHQSHHSHQ HHLPHHFESQ  60
HLHFGGHQIH PSLQALQQIH QTQSPHASHV HRAQHSQHAQ HPPHPLAQLQ QVSQQSAPHT  120
PASHQDVSQH QLQQVHQQQQ QEEQHKQHLR EQQQAQEQQH AQEQMVQQLG LGDPDSPDAA  180
SPIASRPSPT NYSKLLMSAQ QDDEGLEEDR GGSGGNRWPR AETLALIQIR SDLDSSFRDS  240
GVKGPLWEDV SRKLAEMGYN RSGKKCKEKF ENIHKYYKKS KDGRAGRQDG KSYRFFAQLD  300
ALFGGQQTST QVDTDTAAAV LLIGNAPPLG ISPTDQDLNA SVQRPLEIST GITVSRSSGD  360
DNDDDDGPGS GLRDNQQMTK NRKRKLMEDG KTGTHKLQFF ETLMKNMIDK QEAMQRKLLE  420
TMERIEQDRQ AKQESWRRQE MARWQREHAL RAHEHALTTA RDGALISFLQ KVTAHNVQIP  480
KFNTPPQVVI PPTRESEE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024402506.10.0trihelix transcription factor GTL1-like
TrEMBLA0A2K1J0Q50.0A0A2K1J0Q5_PHYPA; Uncharacterized protein
STRINGPP1S19_325V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03680.15e-48Trihelix family protein