PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_7930V3.1.p
Common NamePpDof1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 503aa    MW: 53321.8 Da    PI: 8.0756
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_7930V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.42.7e-37148206260
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++k ++cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG+lrnv vG+grrknk 
  Pp3c17_7930V3.1.p 148 PDKLIPCPRCDSLDTKFCYYNNYNINQPRHFCKSCQRYWTAGGTLRNVLVGAGRRKNKY 206
                        78999****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-28138205IPR003851Zinc finger, Dof-type
PfamPF027019.8E-31150205IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.68152206IPR003851Zinc finger, Dof-type
PROSITE patternPS013610154190IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MSKLRKWMMK EERENSAGSA DTSAIKLFGK TIAVNSGVSD SQETSTKAGT SADAAVVHPC  60
ASQAGSEEVD GASTQSEADE MGSSICNEIR NVEAPKDAPQ ESQVSSEKLA SETMTVSTSI  120
QAPAAAVAQE KQRPLTVEEK KEQCVRKPDK LIPCPRCDSL DTKFCYYNNY NINQPRHFCK  180
SCQRYWTAGG TLRNVLVGAG RRKNKYGSSQ MKQEASEGVN SGITTVRLDH HEGAQPMLPC  240
AINPYGLKVP PMNIPQLAAS CASRQASEAQ STVTSCGKES NKVFTSASAF KPAGPDVSND  300
SVSKLRQRTR TDTPEGKDVS SPGSSPFVSE SPTSHVLTSR VQPQQQEVQQ QAMWTKSNPQ  360
LGFFNGAWPY GYSIGWSGAG PIHGTPAMCS PHPASSGTTS PPSGMCPTPG NVWTGLWASG  420
MPGMPQGMAS MSGMSGVSAM PFGWNMCPGG WTLPWRPVPA VAVQGSADVV VVNSGGFRKR  480
DGANDEGVRK MARIGSPEEV VV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.43420.0gametophore| protonema| sporophyte
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6266970.0AB626697.1 Physcomitrella patens PpDof1 mRNA for Dof transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401077.10.0uncharacterized protein LOC112294633
TrEMBLH1ACS80.0H1ACS8_PHYPA; Dof transcription factor
STRINGPP1S392_2V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-36cycling DOF factor 2
Publications ? help Back to Top
  1. Sugiyama T, et al.
    Involvement of PpDof1 transcriptional repressor in the nutrient condition-dependent growth control of protonemal filaments in Physcomitrella patens.
    J. Exp. Bot., 2012. 63(8): p. 3185-97
    [PMID:22345635]