PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_3860V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 345aa    MW: 37939.9 Da    PI: 6.9307
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_3860V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.81.1e-3355111460
             zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        k l+cprC+s+ntkfCyynnys+sqPr++C+ C+ryWt GG+lrnvP Gg++rk+ +
  Pp3c17_3860V3.1.p  55 KDLPCPRCQSMNTKFCYYNNYSTSQPRHYCHDCQRYWTVGGTLRNVPPGGSCRKRTT 111
                        6789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2053108IPR003851Zinc finger, Dof-type
PfamPF027016.4E-3056110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.69257111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MQLPISHLSE FQETENEEIH AHLAANSGSH SHDEEEGSHS QGSKGSIGPD GNPVKDLPCP  60
RCQSMNTKFC YYNNYSTSQP RHYCHDCQRY WTVGGTLRNV PPGGSCRKRT TTVPQSSSVP  120
HFHPGTPPSS TLTGSEGESE RYQHPGSPPM MAALASMLAH PVTSGFGGFE EQFADLLSFY  180
PTQFSSLLQL AIMQQNQQDM LTSTFPDASI LASGLLMPEV FEPSHLELMH MATMLAEMQR  240
MQELARRQAA AWAEYHREGQ SAVSSGIHRQ SPQNAAAEEA AKNRQYGGSS LHRRPGFWET  300
ALRHSRPNKR RTTNPGVPES SNLSKEQGGT RAATNQPLRQ EHSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.68233e-72protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401091.10.0dof zinc finger protein DOF2.5-like
TrEMBLA0A2K1J2L80.0A0A2K1J2L8_PHYPA; Uncharacterized protein
STRINGPP1S26_282V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-27OBF binding protein 4